KEGG   Thermococcus sp. CL1: CL1_1652Help
Entry
CL1_1652          CDS       T02169                                 

Definition
glutamyl aminopeptidase, M42 family
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
thm  Thermococcus sp. CL1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CL1_1652
Enzymes [BR:thm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CL1_1652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1568121..1569167)
Genome map
AA seq 348 aa AA seqDB search
MVDFELLKRIVEAPGVSGYEFLGVRDVVIEAFKPYVDEIKVDKLGNVIAHKEGKGPKVML
AGHMDQIGLMVTHIEKNGFLRVAPVGGVDPRTLIAQRFKVWVGPNEFVYGVGGSVPPHIQ
KPEQRNKAPTWEQVFIDIGAESKEEAEEMGVKIGTVITWDGRLERLGKHRLVSIAHDDRI
AVYTLVEAARQLSETDADVYFVATVQEEVGLRGAKVSAFGIDPDYGFALDVTIAADVPGT
PEHKQITQLGKGVAIKIMDRSVICHPTIVRWMEELAKKHEIPYQWDILTGGGTDAGAIHL
NKAGVPSGGISIPARYIHSNTEVVDERDVDAAVKLTVKVLEEIPGLKL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtggactttgaactgctcaagaggattgtagaggcgccgggcgtttccggctacgag
tttcttggcgtcagggacgtcgtcatcgaggccttcaagccctacgttgatgagattaag
gttgacaagctgggcaacgtcatagcccacaaggagggcaagggtccaaaggtcatgctc
gccgggcatatggaccagattggcctcatggttacccacatcgagaagaacggcttcctc
cgcgttgcaccggttggaggggtggaccctaggacgctgatagcccagcgcttcaaggtc
tgggttgggccgaacgagttcgtctacggcgtcggtggaagcgttccgccccacattcag
aagccggagcagaggaacaaggccccgacctgggagcaggtcttcattgacatcggtgcc
gagagcaaggaagaggcagaggagatgggcgtcaagataggcacagtcatcacctgggac
ggaaggcttgagaggctcggcaagcaccgcctagtcagcatcgcccacgacgacaggata
gcggtctacaccctcgttgaggccgcgagacagttaagcgagaccgatgccgatgtctac
ttcgtggcaacggttcaggaggaggtagggcttcgcggagctaaggtttcggccttcggc
atcgaccccgactacggcttcgccctcgacgtaaccatagcggccgacgttcccggaacg
ccggagcacaagcagataacccagctcgggaagggcgtcgcgatcaagataatggaccgc
tcggtaatctgccacccgacgatagtgaggtggatggaagagcttgccaagaagcacgag
ataccctaccagtgggacattctcaccggcggaggaacagatgcaggagcgatacacctc
aacaaggccggcgtcccgagcggcggaataagcattccggcgcgctacatacactccaac
accgaggtcgtggacgagagggacgtcgatgccgccgtcaagctgaccgtcaaggtcctc
gaggagatcccggggctgaagctctga

DBGET integrated database retrieval system