KEGG   Thermococcus cleftensis: CL1_1652Help
Entry
CL1_1652          CDS       T02169                                 

Definition
(GenBank) glutamyl aminopeptidase, M42 family
  KO
K20608  
tetrahedral aminopeptidase [EC:3.4.11.-]
Organism
thm  Thermococcus cleftensis
Brite
Enzymes [BR:thm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     CL1_1652
Peptidases [BR:thm01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   CL1_1652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1568121..1569167)
Genome map
AA seq 348 aa AA seqDB search
MVDFELLKRIVEAPGVSGYEFLGVRDVVIEAFKPYVDEIKVDKLGNVIAHKEGKGPKVML
AGHMDQIGLMVTHIEKNGFLRVAPVGGVDPRTLIAQRFKVWVGPNEFVYGVGGSVPPHIQ
KPEQRNKAPTWEQVFIDIGAESKEEAEEMGVKIGTVITWDGRLERLGKHRLVSIAHDDRI
AVYTLVEAARQLSETDADVYFVATVQEEVGLRGAKVSAFGIDPDYGFALDVTIAADVPGT
PEHKQITQLGKGVAIKIMDRSVICHPTIVRWMEELAKKHEIPYQWDILTGGGTDAGAIHL
NKAGVPSGGISIPARYIHSNTEVVDERDVDAAVKLTVKVLEEIPGLKL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtggactttgaactgctcaagaggattgtagaggcgccgggcgtttccggctacgag
tttcttggcgtcagggacgtcgtcatcgaggccttcaagccctacgttgatgagattaag
gttgacaagctgggcaacgtcatagcccacaaggagggcaagggtccaaaggtcatgctc
gccgggcatatggaccagattggcctcatggttacccacatcgagaagaacggcttcctc
cgcgttgcaccggttggaggggtggaccctaggacgctgatagcccagcgcttcaaggtc
tgggttgggccgaacgagttcgtctacggcgtcggtggaagcgttccgccccacattcag
aagccggagcagaggaacaaggccccgacctgggagcaggtcttcattgacatcggtgcc
gagagcaaggaagaggcagaggagatgggcgtcaagataggcacagtcatcacctgggac
ggaaggcttgagaggctcggcaagcaccgcctagtcagcatcgcccacgacgacaggata
gcggtctacaccctcgttgaggccgcgagacagttaagcgagaccgatgccgatgtctac
ttcgtggcaacggttcaggaggaggtagggcttcgcggagctaaggtttcggccttcggc
atcgaccccgactacggcttcgccctcgacgtaaccatagcggccgacgttcccggaacg
ccggagcacaagcagataacccagctcgggaagggcgtcgcgatcaagataatggaccgc
tcggtaatctgccacccgacgatagtgaggtggatggaagagcttgccaagaagcacgag
ataccctaccagtgggacattctcaccggcggaggaacagatgcaggagcgatacacctc
aacaaggccggcgtcccgagcggcggaataagcattccggcgcgctacatacactccaac
accgaggtcgtggacgagagggacgtcgatgccgccgtcaagctgaccgtcaaggtcctc
gaggagatcccggggctgaagctctga

DBGET integrated database retrieval system