KEGG   Thermococcus sp. CL1: CL1_1827Help
Entry
CL1_1827          CDS       T02169                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
thm  Thermococcus sp. CL1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:thm01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:thm00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1752825..1753958)
Genome map
AA seq 377 aa AA seqDB search
MDFELERYVAGILRDIRERGNDAVKEYSIRFDGYAGPFRVTEDEFEEAARSIPRRDREII
LRTVKRLWEYHERQMERERLFIKNGSLYGIIYRPVRRIGIYVPGGKPLPSTLMMVAVPAK
IAGVKEIAVTIPPKDGKVNPYVLYVAKLLGITEVYKLGGIQAIGAMAYGIGMKKVDKIFG
PGNRFVNEAKRQVFGVVGIDSLAGPSEIAVIADETAEKEYVLADLLSQLEHGKDSRAWLL
TTSGELAEFCSREGIEVVLCENLEECVRRANEIAPEHLEIITERPMELVDLIENAGAIYL
GPYTPVPAADYFLGVNHVLPTGGAAKFSGVLTVRDFLKPISLAGVSREEFLAERELGLRL
AEIEGMAFHRRSMEVRR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggattttgagcttgagagatacgtcgccggaatactgcgggatattcgggagagaggt
aatgatgccgtaaaggagtactccatcaggttcgacggctacgccggcccgttccgtgtg
accgaggatgagttcgaggaggccgcgcgaagcattcccaggagggacagggagataatc
ctccgcaccgttaaacgcctgtgggagtaccacgagaggcagatggaaagggaacggctc
ttcatcaaaaacggctccctctacgggataatctaccgtccggtaaggaggataggaatc
tacgtgcccggcggaaaaccgctaccctcgacgctgatgatggtggcagtcccagcaaaa
atcgcgggcgttaaggagatagcggtcacaatcccgccaaaggacggaaaggtgaacccc
tacgtcctctacgttgcaaaactgctcggcatcaccgaggtctacaagctcggtggaatc
caggcgataggtgcgatggcctatggaattggcatgaagaaggtggacaaaatattcggc
cccggaaacaggttcgtcaacgaggccaagaggcaggttttcggggtcgttggcatagac
agcctcgccgggccgtcggagatagcggtgatagcggacgaaacggcagagaaagagtac
gttctggccgaccttctcagccagctggagcacgggaaggacagcagggcctggctcctc
acgacctcaggggaactcgcggagttctgctcccgcgaggggatagaggttgtcctctgc
gaaaacttagaggagtgcgttaggagggccaacgagatagcgccggagcaccttgagata
atcacggagagaccgatggagctcgttgacctcatcgagaacgccggggcgatttacctg
ggcccctacacgccggttccggcggctgattacttcctcggcgtcaaccacgtcctgcca
accggaggggcggcgaagttcagcggtgtcttaactgtgagggacttcctcaagcctata
agccttgcaggggtgagcagagaggagttcctcgcggagagggagctgggtcttcgcttg
gccgagatagagggaatggccttccacaggaggagcatggaggtgaggagatga

DBGET integrated database retrieval system