KEGG   Thermococcus cleftensis: CL1_1827Help
Entry
CL1_1827          CDS       T02169                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
thm  Thermococcus cleftensis
Pathway
thm00340  Histidine metabolism
thm01100  Metabolic pathways
thm01110  Biosynthesis of secondary metabolites
thm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thm00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    CL1_1827
Enzymes [BR:thm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CL1_1827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh HBB
Motif
Other DBs
NCBI-ProteinID: AFL96023
UniProt: I3ZWD9
Position
complement(1752825..1753958)
Genome map
AA seq 377 aa AA seqDB search
MDFELERYVAGILRDIRERGNDAVKEYSIRFDGYAGPFRVTEDEFEEAARSIPRRDREII
LRTVKRLWEYHERQMERERLFIKNGSLYGIIYRPVRRIGIYVPGGKPLPSTLMMVAVPAK
IAGVKEIAVTIPPKDGKVNPYVLYVAKLLGITEVYKLGGIQAIGAMAYGIGMKKVDKIFG
PGNRFVNEAKRQVFGVVGIDSLAGPSEIAVIADETAEKEYVLADLLSQLEHGKDSRAWLL
TTSGELAEFCSREGIEVVLCENLEECVRRANEIAPEHLEIITERPMELVDLIENAGAIYL
GPYTPVPAADYFLGVNHVLPTGGAAKFSGVLTVRDFLKPISLAGVSREEFLAERELGLRL
AEIEGMAFHRRSMEVRR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggattttgagcttgagagatacgtcgccggaatactgcgggatattcgggagagaggt
aatgatgccgtaaaggagtactccatcaggttcgacggctacgccggcccgttccgtgtg
accgaggatgagttcgaggaggccgcgcgaagcattcccaggagggacagggagataatc
ctccgcaccgttaaacgcctgtgggagtaccacgagaggcagatggaaagggaacggctc
ttcatcaaaaacggctccctctacgggataatctaccgtccggtaaggaggataggaatc
tacgtgcccggcggaaaaccgctaccctcgacgctgatgatggtggcagtcccagcaaaa
atcgcgggcgttaaggagatagcggtcacaatcccgccaaaggacggaaaggtgaacccc
tacgtcctctacgttgcaaaactgctcggcatcaccgaggtctacaagctcggtggaatc
caggcgataggtgcgatggcctatggaattggcatgaagaaggtggacaaaatattcggc
cccggaaacaggttcgtcaacgaggccaagaggcaggttttcggggtcgttggcatagac
agcctcgccgggccgtcggagatagcggtgatagcggacgaaacggcagagaaagagtac
gttctggccgaccttctcagccagctggagcacgggaaggacagcagggcctggctcctc
acgacctcaggggaactcgcggagttctgctcccgcgaggggatagaggttgtcctctgc
gaaaacttagaggagtgcgttaggagggccaacgagatagcgccggagcaccttgagata
atcacggagagaccgatggagctcgttgacctcatcgagaacgccggggcgatttacctg
ggcccctacacgccggttccggcggctgattacttcctcggcgtcaaccacgtcctgcca
accggaggggcggcgaagttcagcggtgtcttaactgtgagggacttcctcaagcctata
agccttgcaggggtgagcagagaggagttcctcgcggagagggagctgggtcttcgcttg
gccgagatagagggaatggccttccacaggaggagcatggaggtgaggagatga

DBGET integrated database retrieval system