KEGG   Thermosynechococcus sp. NK55: NK55_01065Help
Entry
NK55_01065        CDS       T02977                                 

Definition
glycosyl hydrolase family 116 (EC:3.2.1.-)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
thn  Thermosynechococcus sp. NK55
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thn00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NK55_01065
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    NK55_01065
Enzymes [BR:thn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     NK55_01065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(216982..219339)
Genome map
AA seq 785 aa AA seqDB search
MIEFANCAWTRAIGQGWENPYRVRYASNLDDGPWHGMPLGGFGAGCIGRSSAGDFNLWHL
DGGEHIFGTLPACQFSLFEQGERTQAYALGTPPSDGRLSTWQWYPTGKGFYAARYPRSWF
VYEGVFSAQITCEQFSPILPHNYQETSYPVAVFLWTFSNPTDQSLTLSLMFSWQNTVGWF
RNTAPSSAIAIRDDGSPVYTYTPRWGQSDGNFNELIQTASFQGWRLRRMPHPNPPQEGDG
EWAALIPTGLGEFFGCSRWQPEGDGAQLWQSFSVDGSLPFVHDPTPAAVGEQVAAAFALR
FSLAPGARKQIPVVLAWDFPVTEFGKGVIYYRRYTDFWDRRGTNAVTLAAQALAAYATWQ
EQIRTWQAPILSHPDWPDWFKMALCNELYVLSSGGSLWSAASDRDPVGQFAVLECLDYRW
YESLDVRLYGSFALLQLWPELEKSVMRAFARAIPTADPTLRIIGYFYRGDPETAYKAPRK
LANAVPHDLGAPNEHPWEKTNYTAYQDCNLWKDLASDFVLLVYRDFLFTGGTDLDFAREC
WSAVVAALDYLKQFDQDGDGLPENGGAPDQTYDDWKLQGVSAYCGGLWLAALEAAIALGT
ILQQPQVETYRQWLSQARPRYHQLLWNGEYYRLDTGSGSDVIMADQLCGQFYAQLLGLVD
IVPPDCCDRALRKIYDTCFLKFHNGQLGAANGLLPNGQPENPHATHPLEVWTGINFGLAA
FLWQRGMTHEAWRLAEVVVRQIYENGLQFRTPEAITAKGTFRASMYLRPMAIWALALVSG
GSQSA
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaatttgccaactgtgcttggactcgggcgatcggccaaggctgggagaatcct
tatcgcgttcgctatgccagcaatttagacgatggcccttggcatggaatgcccctcggt
ggctttggcgctggctgtattggccgttcctccgccggggacttcaacctctggcacctt
gatggcggagagcacatctttggcaccctgcccgcctgtcaatttagtctttttgagcaa
ggagagcggacacaagcctacgccctaggaactcccccgagcgatggccgcctcagtact
tggcaatggtaccccactggtaaaggcttctacgctgcccgctatccccgcagttggttt
gtctatgagggagtctttagcgcccagatcacctgcgaacagttttcaccgattctgccc
cacaactaccaagaaaccagttaccctgtggcggtgtttctgtggacattcagcaatccc
acagatcagtccctcaccctgagcctaatgttctcgtggcaaaataccgtcggttggttt
cgcaatactgccccttcttccgccattgccatccgcgatgatggtagccctgtctatacc
tacacgccccgctggggtcaaagtgacggcaattttaatgaactgattcaaacggcgtct
tttcaaggttggcgactgcggcgtatgccccaccccaacccaccccaagagggggatggc
gaatgggcagcattaattcccacaggccttggcgagttttttggctgtagtcgctggcag
ccagagggagatggggcacaactatggcaatcattttccgtggatggttccctaccgttt
gttcatgaccccaccccagcggcagtgggagaacaggtggccgccgcttttgccctgcgc
ttttccttggcaccgggagcaagaaaacaaattcctgtggtcctagcgtgggactttccc
gtgaccgagtttggcaagggggtgatctattaccgtcgttacacggatttttgggatcgc
cgagggactaatgccgtcacccttgccgcccaagccctcgccgcctatgccacgtggcaa
gagcagattcgcacttggcaagcaccgatcctcagccaccccgactggccggactggttc
aagatggcactgtgtaatgagctatacgttctcagtagtggggggagcctctggagtgcg
gccagcgatcgcgatcctgtgggtcagtttgccgttttagaatgtcttgactaccgctgg
tatgaaagtctggatgtgcgtctttatggctcctttgccctcctgcaactgtggccagag
ctggaaaaatccgtgatgcgtgcctttgcgcgggccattccgacagcggatccaaccctg
agaatcattggctacttctatcgcggtgatcccgaaaccgcctacaaagcgcctcgtaaa
ctggccaatgccgttccccacgatctcggtgctcccaatgagcacccttgggaaaagacc
aactacacggcctaccaagactgtaatctgtggaaagatttggcctcggattttgtgctg
ttggtctatcgagactttttgttcactggggggacagatctcgatttcgcccgtgagtgc
tggtcggcggtggtggcagccttagactatttgaaacaatttgaccaggatggcgatggg
ctgccagaaaatgggggtgccccggatcaaacctacgatgactggaaactacagggagtc
agtgcctactgtggtggcttgtggttggcagccctagaggcggcgatcgccctcggcacg
attctccaacaaccgcaggtggaaacctaccgccagtggcttagccaagctcgcccccgc
taccatcaactgctgtggaatggcgagtactatcgtctcgatacgggcagtggctccgat
gtgatcatggcggatcaactgtgtggccagttttatgcccaactcttgggcttggtggat
attgtgccccccgactgttgcgatcgcgccctgcggaaaatttacgacacctgttttctc
aaatttcacaacggccagttgggggctgccaatggtctattgcccaacgggcaacctgaa
aacccccacgctacccatccccttgaagtatggacggggattaactttggcttggccgcc
tttttgtggcagcggggaatgacccacgaagcatggcgtttagccgaagtggtggtacgg
caaatctacgagaatggcctgcaatttcggacgccggaggcgattacggccaagggtacc
ttccgtgccagtatgtacctgcgccctatggctatctgggcactggctcttgtcagtgga
ggctcacaatccgcctaa

DBGET integrated database retrieval system