KEGG   Thermosynechococcus sp. NK55: NK55_04160Help
Entry
NK55_04160        CDS       T02977                                 

Gene name
rbcS
Definition
ribulose bisphosphate carboxylase small subunit RbcS (EC:4.1.1.39)
Orthology
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
thn  Thermosynechococcus sp. NK55
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:thn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NK55_04160 (rbcS)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NK55_04160 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NK55_04160 (rbcS)
Enzymes [BR:thn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NK55_04160 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(897775..898131)
Genome map
AA seq 118 aa AA seqDB search
MKTLPKERRYETFSYLPPLSDAQIARQIQYAIDQGYHPCVEFNETSDAETHYWTMWKLPL
FNCTNAQEVLNEVQQCRSEYPNCFIRVVAFDNIKQCQVMGFIVYKPNQTNSGYSGYRY
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaagacactgcctaaagagcgtcgttacgaaaccttctcctacctgcctcccctcagc
gatgcccaaattgctcgccaaatccagtacgcgattgatcagggctatcacccctgtgtg
gagttcaatgagacctccgatgccgaaacccactactggacgatgtggaaactgccgctg
tttaactgcactaatgcccaagaggtgctgaatgaagtgcagcagtgccgctcggaatat
cccaactgcttcattcgtgttgttgcctttgacaatatcaagcagtgccaagtgatgggc
tttattgtctataagcccaatcagactaacagcggctacagcggttatcgctattaa

DBGET integrated database retrieval system