KEGG   Thermosynechococcus sp. NK55: NK55_04900Help
Entry
NK55_04900        CDS       T02977                                 

Gene name
desC2
Definition
delta-9 acyl-lipid desaturase DesC2 (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
thn  Thermosynechococcus sp. NK55
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:thn00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NK55_04900 (desC2)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    NK55_04900 (desC2)
Enzymes [BR:thn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     NK55_04900 (desC2)
Lipid biosynthesis proteins [BR:thn01004]
 Desaturase
  First
   NK55_04900 (desC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1049482..1050270
Genome map
AA seq 262 aa AA seqDB search
MGGDFFMGIVHLGALLALVPGTFSWSAVLLCFVLYWVSGGLGITLGWHRLVTHRSFQCPK
WLEYFFVFCGTLACEGGITEWVGLHRNHHLHSDQELDQHNSQKGFWWSHMGWMLQEVPAK
AAVERLTKDINTDPVYRFLNRYFLLIQVALGVLLYLWGGLPFVVWGIFVRLVLVYHLTWF
VNSATHRFGYRTFESGDRSTNCWWVALLTFGEGWHNNHHAYPHSARHGLQWWEFDITWIT
IRALQVMGLAQKVRLVEAPRNQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ttggggggtgatttttttatgggtattgtccatttgggagcgttgctggccttggtgcct
gggacgttttcatggtcggcagtgctcctctgttttgtcctctactgggtctctggtggt
ttggggattactttgggatggcatcgtcttgtcactcatcgtagtttccaatgtccgaaa
tggctggaatacttttttgttttttgcggtactttggcctgtgagggtggcatcactgaa
tgggtcggcctccaccgcaatcatcacctccactccgatcaagaactggatcagcacaat
tcccaaaagggcttttggtggtcccacatgggttggatgctccaagaagtgcccgctaag
gcagcggtggaacgccttaccaaggacattaacactgaccctgtctatcgctttttgaat
cggtattttctccttattcaagtggctttaggggtgttgttatatctctggggtggactg
ccctttgtggtctggggcatctttgtccgcctggtgctggtgtatcacctaacttggttt
gtcaatagtgcgacccacaggtttggctaccgcacctttgaatcgggcgatcgctccaca
aattgttggtgggttgccctcttgacgtttggtgaaggctggcacaacaaccaccacgcc
tatccccattcggcacgccacggtctgcaatggtgggaatttgatatcacgtggatcaca
attcgagcactgcaagtaatgggtctggcccaaaaggtgcggcttgtggaagcccccagg
aatcagtaa

DBGET integrated database retrieval system