KEGG   Thermosynechococcus sp. NK55: NK55_05235Help
Entry
NK55_05235        CDS       T02977                                 

Gene name
desF
Definition
syn-2 delta 9 acyl-lipid fatty acid desaturase DesF (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
thn  Thermosynechococcus sp. NK55
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:thn01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:thn01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1115882..1116721)
Genome map
AA seq 279 aa AA seqDB search
MTSSLELQPQTPRLNWGFVLFLGAVHLLAAAALLFFSWSALAVTIFLHWLFGSIGICLGY
HRLLSHRSFQVPQWLEYVIAVVGALAMQGGPIFWVAGHRLHHAHTEDEIKDPYSARRGFW
WSHMLWLVYPQSRFFNAEEYARFAPDLTRDPFYRWLDRYFLLLQLPLALLLYGLGGWSWL
LWGMFMRAVFLWHSTWLINSATHKWGYRRFETEDNSRNLWWAALLTYGEGWHNNHHAYPH
VAKAGWYWWEVDPTWWVIRTLQGLGLAAKVQLPPPTALS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacatcatccttagaattgcaaccccagaccccccgcctcaattggggctttgtcctc
tttttaggggcggtacatcttttagccgcggctgctcttttgtttttctcctggtcagca
ttagccgtcacgatctttctgcactggctctttggcagtatcggtatttgcttgggatac
catcgtcttttaagtcaccgcagtttccaagtgccccagtggctggagtacgtcattgct
gttgtgggtgccttggccatgcagggaggcccgattttttgggtagcagggcaccgcttg
caccatgcccacaccgaggacgagattaaggatccctactcagcacggcggggcttttgg
tggagccatatgctgtggcttgtctatccgcagtcccggtttttcaatgccgaggagtat
gcccgctttgcccccgacttaacacgagatcccttttaccgctggctggatcgctacttt
ttactcctgcagcttccccttgcgctgctcctctatggcttagggggttggtcctggctg
ttgtgggggatgtttatgcgagccgtttttctttggcacagcacttggttgattaactct
gccacccacaaatggggctatcgtcgctttgagaccgaggataactcacgcaatctctgg
tgggcagccctcctcacctatggcgaaggttggcacaacaaccaccatgcctatccccac
gtggccaaggcgggctggtactggtgggaagtggatcccacctggtgggtgattcgcaca
ctccaaggactgggtcttgccgccaaggtacagttgccgccgcccacagcgttgtcctaa

DBGET integrated database retrieval system