KEGG   Thermosynechococcus sp. NK55: NK55_06230Help
Entry
NK55_06230        CDS       T02977                                 

Gene name
pepC
Definition
phosphoenolpyruvate carboxylase PepC (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
thn  Thermosynechococcus sp. NK55
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NK55_06230 (pepC)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NK55_06230 (pepC)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NK55_06230 (pepC)
   00680 Methane metabolism
    NK55_06230 (pepC)
Enzymes [BR:thn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NK55_06230 (pepC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1322173..1325208)
Genome map
AA seq 1011 aa AA seqDB search
MTSVLDATNRDRLIESESLAARTLQERLRLVEEVLVDVLAAESGQELVDLLRRLGALSSP
EGHVLHAPEGELLKVIESLELNQAIRAARAFNLYFQIINIVEQHYEQQYNRERAAQERLR
RRSVMSEPISGVSGEGFPLPHNAANATAVRSGPSERLEHSLYEAIPATQQYGSFAWLFPR
LQMLNVPPRHIQKLLDQLDIKLVFTAHPTEIVRQTIRDKQRRVARLLEQLDVLEGASAHL
TDWNAQTLRAQLMEEIRLWWRTDELHQFKPEVLDEVEYTLHYFKEVIFAVIPKLYRRLEQ
SLHETFPTLEPPRHNFCRFGSWVGGDRDGNPYVKPEVTWQTACYQRNLVLEEYIKSVERL
INLLSLSLHWCDVLPDLLDSLEQDQRQLPSIYDQYAVRYRQEPYRLKLAYVLKRLQNTRD
RNRALQTYCIRRHEAEELNNGQFYCHGEEFLAELLLIQRNLKETGLACRELDDLICQVQV
FGFNLAALDIRQESTCHAEALNEITAYLGILPCPYTELSETERTRWLLSELSTRRPLIPG
ELPFSDRTNEIIETFRMVRQLQQEFGTDLCNTYIISMSHEVSDLLEVLLFAKEAGLFDPA
TGASTLQAIPLFETVEDLKHAPAVLTQLFSLPFCRSYLGSNSTPFLQEVMLGYSDSNKDS
GFLSSNWEIYKAQQQLQKIAENFGFQLRIFHGRGGSVGRGGGPAYAAILAQPAQTIKGRI
KITEQGEVLASKYSLPELALFNLETVATAVIQASLLRSSIDEIEPWHEIMEELATRSRQC
YRHLIYEQPEFIEFFNEVTPIQEISQLQISSRPTRRGGKKTLESLRAIPWVFSWTQTRFL
LPAWYGVGTALKEFLEEKPAEHLSLLRYFYYKWPFFRMVISKVEMTLAKVDLEIARYYVQ
ELSQPQNREAFFRLYDQIAQEHRLTTELVLTITGHERLLDGDPALQRSVQLRNRTIVPLG
FLQVSLLKRLRQHNSQTTSGAILRSRYGRGELLRGALLTINGIAAGMRNTG
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagtcctcgatgcgaccaatcgcgatcgcttaattgaaagtgaaagtttagca
gcccgtaccctacaggaacggttgcgactggtggaagaggtcttggtcgatgtcttggcg
gcagaatcgggtcaagaattggttgatctattgcggcgcttaggtgctctctcttcgcca
gaaggtcatgtgctccatgccccagaaggggaactgctcaaggtcattgaatccctcgaa
ctcaatcaagccattagagcggcccgtgcttttaacctctactttcaaattattaacatc
gttgagcagcactacgaacaacaatacaaccgcgaacgcgctgcccaagagagattgcgg
cgccgcagcgtcatgagtgaaccgatttccggtgtcagtggtgaaggttttccgctgcct
cataatgctgccaacgcaacggctgtgcgcagtgggccgagtgaacgcctagagcatagt
ctctacgaagccattcccgctactcagcagtatggttcctttgcttggctctttcctcgg
ctgcagatgctgaatgtgccgccgcgccatattcaaaagcttttggatcaactggacatt
aagctggtttttactgctcacccgacggagattgtacggcaaacaattcgtgataagcag
cggcgggttgcccgattactcgagcaactggatgtgctagagggggcttctgcacacctg
acggattggaatgcccaaactctacgggcacaactgatggaggaaattcgcctctggtgg
cgcacggatgagttgcaccaatttaagccggaagtgcttgatgaggtggaatacaccctc
cactacttcaaggaggtaatttttgctgtcattcccaagctctatcggcgcctggagcag
tcattgcatgaaacctttcccacgcttgagcccccccgtcacaatttctgccgctttggt
tcttgggtggggggcgatcgcgatggcaatccctatgtcaaaccagaagtaacgtggcaa
accgcctgctatcagcgcaacttagttcttgaggaatatattaagtccgttgagcgctta
atcaatttgctcagcctgtccctgcactggtgcgatgtgctgccggatttgctagattcc
cttgagcaggatcagcggcaactccctagtatctatgaccagtatgcggtgcgctatcgg
caggaaccctaccgcctgaaactggcctatgtgctcaaacggctgcaaaatacccgcgat
cgcaaccgggcgctgcaaacctactgcattcgccgccatgaggcggaagagttaaataat
gggcagttttactgccacggtgaagaattcttggcagaattgctgctaattcagcgtaac
ctcaaggaaacaggactggcctgccgcgaattggatgacttgatttgccaagtgcaggtc
tttggctttaatttggcagccttggatattcgccaagaaagcacctgtcacgctgaggcc
ctcaatgaaattaccgcctatttgggtattctcccctgtccctatacagaactctcagaa
accgaacgcactcgctggctcctcagtgaactctcgacccgtcgccccttgattccgggg
gaactcccctttagcgatcgcaccaatgaaatcattgaaacattccgcatggtgcggcaa
ctccagcaggaatttggcaccgatttgtgcaatacctacatcatcagcatgagccacgag
gtcagcgatctgttggaggtactcctctttgccaaggaggcaggcctctttgatccagcc
actggagctagtaccctgcaagccattcctctgtttgaaacggtcgaagatctcaaacac
gccccggcggtgctgacgcaactattctctctccccttttgccggagctatcttggaagc
aacagtaccccctttctgcaggaggtcatgctgggctattccgacagcaataaggattcc
ggctttctcagtagcaactgggaaatttacaaggcgcagcaacagctccagaaaattgct
gagaattttggcttccaactgcgcattttccacggtcggggtggctcagtgggtcggggt
ggtggacctgcctatgcagcgattttggcgcagccagcgcaaacgattaagggacgaatc
aagattactgagcaaggggaggtactggcttccaaatactcgttgccggaactagcgctc
tttaacctcgaaacagtggccacagcggtaatccaagctagtttgctgcgcagtagtatt
gatgaaattgagccttggcacgagattatggaggagttggccacgcgatcgcgccagtgc
tatcgccatctcatctatgagcagccagaattcattgaattctttaacgaagtcacccca
atccaagagattagccaactgcaaattagctcacggccaacacggcgggggggcaagaaa
acccttgagagcctgcgggcaattccttgggtctttagttggacgcaaacccgtttcctg
ctgccggcttggtatggtgtgggtactgccctaaaggaattccttgaggaaaaacccgct
gagcatctttccctcttgcgctacttctactacaaatggcctttcttccgcatggtgatt
tctaaggttgagatgacccttgccaaggtcgatctagagattgcccgctactatgtccaa
gaactcagccagccccaaaaccgtgaagccttcttccgcctctacgatcagattgctcag
gaacatcgcctgaccacggaattagtgctcacgattactggccatgagcggctactcgat
ggggatccggcgcttcagcgatcagtgcaactgcgcaatcgcaccattgttcctttgggg
ttcctgcaagtatctcttttgaaacggctgcgccagcacaatagccaaactacctctggg
gcaattttgcgctcccgctatggtcggggtgaattgctccggggggcactcttgaccatc
aatggcatagcagcggggatgcgcaatacgggctaa

DBGET integrated database retrieval system