KEGG   Thermosynechococcus sp. NK55: NK55_11555Help
Entry
NK55_11555        CDS       T02977                                 

Gene name
desC
Definition
delta-9 acyl-lipid desaturase DesC (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
thn  Thermosynechococcus sp. NK55
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:thn01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:thn01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2422312..2423145)
Genome map
AA seq 277 aa AA seqDB search
MTQATVAKPPIAWPTATFIIFVHLGALLAFLPSMFSWRAVLLALVLHWLTAGIGITLGWH
RLVSHRSFQVPKWLEYFLVFCGTLSMQGGPIWWVGLHRHHHLYSDQPNDHHDSRKGFWWS
HIEWMFREVPAEAEIPRFTKDIADDPVYQFLDKYFLPIQVVLAIVLYLWGGWPFVVWGIF
VRLVTVYHTTWLVNSATHTFGYRTFETTDHSTNCWWVALLTFGEGWHNNHHAYQYSARHG
LQWWELDLTWLTIRFLQLLGLATKVRLVEAPAVSSQD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagcgaccgttgccaaaccccccattgcctggcctacggcgacctttattatt
tttgtacacctcggtgctcttcttgcttttttacccagcatgtttagctggagagcagtc
ctgctggcccttgtgctccactggttaaccgctggcatcggtattacccttggttggcac
cgtctggtctcccatcgtagcttccaagttcccaagtggctggagtatttcctggtcttt
tgcggcacgctctcaatgcaaggggggccgatttggtgggttgggctgcaccgccatcac
catctgtactccgatcaaccgaatgatcaccacgattcccgtaagggcttttggtggagc
catattgaatggatgtttcgtgaggtgccggcggaggcagaaattccccgtttcaccaaa
gatattgctgatgaccccgtctatcaattccttgacaagtactttcttcccattcaggtg
gtcttggccattgtcctttatctttgggggggctggccatttgtggtttggggaattttt
gtgcggcttgtaaccgtctatcacaccacttggctggtcaatagtgctacccataccttt
ggctatcgcacgtttgaaactacggatcactcaacgaattgctggtgggtagccctgtta
acctttggtgagggctggcacaataatcaccacgcctatcaatactcggcacgccatggt
ttgcagtggtgggagctggatctgacgtggctcaccattcgcttcttgcaattgctgggc
ttggctacgaaggtgcgcttggtggaggcaccggcagtctcttcccaagactag

DBGET integrated database retrieval system