KEGG   Thermococcus sp. ES1: TES1_1307Help
Entry
TES1_1307         CDS       T03005                                 

Definition
4-aminobutyrate aminotransferase 1
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ths  Thermococcus sp. ES1
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ths00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TES1_1307
   00650 Butanoate metabolism
    TES1_1307
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TES1_1307
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TES1_1307
Enzymes [BR:ths01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     TES1_1307
Amino acid related enzymes [BR:ths01007]
 Aminotransferase (transaminase)
  Class III
   TES1_1307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(1240507..1241838)
Genome map
AA seq 443 aa AA seqDB search
MKKEEIIFRYSKVFPKAARVTYAPIVGVKAKNAKVWDIEGREYIDFLSDAAVQNVGHNNE
RVVRAIKEQADELIHFTFIYGYTVEPLLLAEKLVKISPIENSKVVLGLSGSDANDGAIKF
ARAYTKRRTILSYLGSYYGATYGAMSITGLDFETRALVGELSDVHYIPYPDCYRCPFGQE
KGKCHLKCISYLEYKFEKEVYADGVAALFAEPIQGDAGMIVPPDDYFKKLKKILDEHGIL
LVVDEVQSGLGRTGKWFAIEHFGVVPDIITLAKPLGGGLPISAIIGKEEIMESLPPLGHT
FTLSGSPVVSRAALAVIEEIEEKNLLKRAEKLGDYTMKRLKKMQEEHELIGDVRGKGLMI
GVDLVKDRETKERAFDEAKKVVWRAYELGLVLAFLHGNVLRIQPPLTIEKELLDEGLDRL
EQAIADVEEGKVDDKVLKIVQGW
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagaggagataatttttcgatattcaaaagtgttcccaaaagctgctcgtgta
acttatgccccaattgttggtgttaaagcaaaaaatgccaaagtttgggacattgaggga
agagaatacatagatttcctctctgatgctgctgttcaaaatgttggacataataatgag
agagttgtgagagcgataaaggagcaagcggatgagttgatacacttcactttcatctat
ggctatactgttgaacctctcctcctggctgaaaagcttgttaagatttcaccaatagag
aattctaaagtggttttgggcttaagtggtagcgatgcaaatgacggagcaattaagttc
gcaagagcatacacaaaaagaagaacaattttaagttacttggggagctattacggagca
acgtatggggctatgagcataacaggtcttgattttgagactagagccttggtgggagaa
ctgagcgatgtgcattatatcccctatcccgactgttatcgttgtccatttggacaagaa
aagggaaaatgtcaccttaagtgtatatcctaccttgaatataaatttgagaaagaagtt
tatgcagatggtgttgccgctctatttgctgagcctatccagggagatgctgggatgata
gttcctccagatgattacttcaaaaagctcaagaaaatcctcgatgagcatgggattctc
ttagttgttgacgaagttcaaagcggattaggaaggactggcaagtggttcgcaattgag
cattttggagttgtaccggatataataacgctcgcaaaacctttgggaggagggttgcca
ataagcgccatcatagggaaggaggaaatcatggaatctttaccgccattggggcataca
tttacgcttagtggaagtccagtggtgagcagagcagctttggcagttattgaagaaatt
gaagaaaagaatttgcttaaaagagctgagaagcttggagattacaccatgaagaggctc
aagaaaatgcaagaagagcatgaactcatcggagatgttagaggaaagggcctgatgatt
ggtgttgatttggtgaaagacagggaaacaaaggaaagagcttttgacgaagctaagaaa
gttgtttggagagcttatgagcttggcttggtcttagcattccttcatggaaatgtcctc
agaattcagccccctttgacgatagagaaggagcttttggatgagggcctagatagactg
gagcaagcaattgcagatgttgaagaaggaaaagttgatgacaaagttttgaagatagtg
caaggctggtga

DBGET integrated database retrieval system