KEGG   Thermococcus paralvinellae: TES1_1307Help
Entry
TES1_1307         CDS       T03005                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase 1
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ths  Thermococcus paralvinellae
Pathway
ths00250  Alanine, aspartate and glutamate metabolism
ths00410  beta-Alanine metabolism
ths00640  Propanoate metabolism
ths00650  Butanoate metabolism
ths01100  Metabolic pathways
ths01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ths00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TES1_1307
   00650 Butanoate metabolism
    TES1_1307
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TES1_1307
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TES1_1307
Enzymes [BR:ths01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     TES1_1307
Amino acid related enzymes [BR:ths01007]
 Aminotransferase (transaminase)
  Class III
   TES1_1307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Methyltransf_33
Motif
Other DBs
NCBI-ProteinID: AHF80687
UniProt: W0I7G3
Position
complement(1240507..1241838)
Genome map
AA seq 443 aa AA seqDB search
MKKEEIIFRYSKVFPKAARVTYAPIVGVKAKNAKVWDIEGREYIDFLSDAAVQNVGHNNE
RVVRAIKEQADELIHFTFIYGYTVEPLLLAEKLVKISPIENSKVVLGLSGSDANDGAIKF
ARAYTKRRTILSYLGSYYGATYGAMSITGLDFETRALVGELSDVHYIPYPDCYRCPFGQE
KGKCHLKCISYLEYKFEKEVYADGVAALFAEPIQGDAGMIVPPDDYFKKLKKILDEHGIL
LVVDEVQSGLGRTGKWFAIEHFGVVPDIITLAKPLGGGLPISAIIGKEEIMESLPPLGHT
FTLSGSPVVSRAALAVIEEIEEKNLLKRAEKLGDYTMKRLKKMQEEHELIGDVRGKGLMI
GVDLVKDRETKERAFDEAKKVVWRAYELGLVLAFLHGNVLRIQPPLTIEKELLDEGLDRL
EQAIADVEEGKVDDKVLKIVQGW
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagaggagataatttttcgatattcaaaagtgttcccaaaagctgctcgtgta
acttatgccccaattgttggtgttaaagcaaaaaatgccaaagtttgggacattgaggga
agagaatacatagatttcctctctgatgctgctgttcaaaatgttggacataataatgag
agagttgtgagagcgataaaggagcaagcggatgagttgatacacttcactttcatctat
ggctatactgttgaacctctcctcctggctgaaaagcttgttaagatttcaccaatagag
aattctaaagtggttttgggcttaagtggtagcgatgcaaatgacggagcaattaagttc
gcaagagcatacacaaaaagaagaacaattttaagttacttggggagctattacggagca
acgtatggggctatgagcataacaggtcttgattttgagactagagccttggtgggagaa
ctgagcgatgtgcattatatcccctatcccgactgttatcgttgtccatttggacaagaa
aagggaaaatgtcaccttaagtgtatatcctaccttgaatataaatttgagaaagaagtt
tatgcagatggtgttgccgctctatttgctgagcctatccagggagatgctgggatgata
gttcctccagatgattacttcaaaaagctcaagaaaatcctcgatgagcatgggattctc
ttagttgttgacgaagttcaaagcggattaggaaggactggcaagtggttcgcaattgag
cattttggagttgtaccggatataataacgctcgcaaaacctttgggaggagggttgcca
ataagcgccatcatagggaaggaggaaatcatggaatctttaccgccattggggcataca
tttacgcttagtggaagtccagtggtgagcagagcagctttggcagttattgaagaaatt
gaagaaaagaatttgcttaaaagagctgagaagcttggagattacaccatgaagaggctc
aagaaaatgcaagaagagcatgaactcatcggagatgttagaggaaagggcctgatgatt
ggtgttgatttggtgaaagacagggaaacaaaggaaagagcttttgacgaagctaagaaa
gttgtttggagagcttatgagcttggcttggtcttagcattccttcatggaaatgtcctc
agaattcagccccctttgacgatagagaaggagcttttggatgagggcctagatagactg
gagcaagcaattgcagatgttgaagaaggaaaagttgatgacaaagttttgaagatagtg
caaggctggtga

DBGET integrated database retrieval system