KEGG   Thermococcus paralvinellae: TES1_1540Help
Entry
TES1_1540         CDS       T03005                                 

Definition
(GenBank) ribokinase
  KO
K21056  
alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
ths  Thermococcus paralvinellae
Brite
Enzymes [BR:ths01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     TES1_1540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1442658..1443536
Genome map
AA seq 292 aa AA seqDB search
MFDVVAIGNLNYDIIMLVDRFPEFHEKIPAKDAYFGLGGAAGNTATWLANMGLKVGFIGA
VGKDEIGDAHINFFKKIGVDVEGIRIVDVPSGVAVAIIKGEDKRIVKYLGANAYRELDFE
YLAKTRHIHLSSNPEKLIIDAVNFAYERGITVSLDIGEAKIPEEIEEKITYLLMNEDEFK
RKFGSLEKITEVKAKNVIVTLNGGGALVRDESKNVFEVRGLSAEVIDSTGAGDSFDAGLI
YGVLNGWSLKDAAKLGMLLAYLTVQKVGARSAVVPLEEIKKKAKELNLNLPF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacgtggttgcaatagggaacctcaactacgacataataatgctcgttgaccgc
tttcccgaattccatgaaaagataccagcgaaagatgcctactttggactcggaggggca
gcgggaaatacagcgacatggttagctaatatgggccttaaagtgggatttataggggct
gtagggaaagacgaaattggagatgcccacataaacttcttcaaaaaaattggcgtggac
gtggaagggataagaatcgttgatgttccttcaggtgttgccgtggcaataataaagggc
gaagacaagagaatcgtgaagtatttgggagccaatgcatatagagaacttgattttgaa
tatttagctaagacaagacacatccatctttcatcaaatccggaaaagctcatcatcgat
gcagtaaactttgcttatgagcgtggaattacagtttcactcgatatcggagaggcaaaa
atcccagaggaaattgaagagaaaataacatatctgctcatgaacgaggatgagtttaag
agaaagttcggaagcttggagaagattacagaagttaaagcaaaaaacgtaattgtgaca
ttaaatggaggaggtgctttagttagagatgaaagtaagaatgtctttgaagtaagaggc
ttgagtgccgaagttatagattctacaggtgctggagattcctttgatgctggacttatt
tatggagtcctcaacggctggagcttaaaggatgctgcaaagcttggaatgttattagct
tatctgactgttcagaaagtcggtgcaaggagtgccgtggttcctcttgaagagataaag
aagaaagcaaaagaattaaacctcaacctgcctttctag

DBGET integrated database retrieval system