KEGG   Thermococcus sp. ES1: TES1_1540Help
Entry
TES1_1540         CDS       T03005                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ths  Thermococcus sp. ES1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ths00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TES1_1540
Enzymes [BR:ths01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TES1_1540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
Position
1442658..1443536
Genome map
AA seq 292 aa AA seqDB search
MFDVVAIGNLNYDIIMLVDRFPEFHEKIPAKDAYFGLGGAAGNTATWLANMGLKVGFIGA
VGKDEIGDAHINFFKKIGVDVEGIRIVDVPSGVAVAIIKGEDKRIVKYLGANAYRELDFE
YLAKTRHIHLSSNPEKLIIDAVNFAYERGITVSLDIGEAKIPEEIEEKITYLLMNEDEFK
RKFGSLEKITEVKAKNVIVTLNGGGALVRDESKNVFEVRGLSAEVIDSTGAGDSFDAGLI
YGVLNGWSLKDAAKLGMLLAYLTVQKVGARSAVVPLEEIKKKAKELNLNLPF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacgtggttgcaatagggaacctcaactacgacataataatgctcgttgaccgc
tttcccgaattccatgaaaagataccagcgaaagatgcctactttggactcggaggggca
gcgggaaatacagcgacatggttagctaatatgggccttaaagtgggatttataggggct
gtagggaaagacgaaattggagatgcccacataaacttcttcaaaaaaattggcgtggac
gtggaagggataagaatcgttgatgttccttcaggtgttgccgtggcaataataaagggc
gaagacaagagaatcgtgaagtatttgggagccaatgcatatagagaacttgattttgaa
tatttagctaagacaagacacatccatctttcatcaaatccggaaaagctcatcatcgat
gcagtaaactttgcttatgagcgtggaattacagtttcactcgatatcggagaggcaaaa
atcccagaggaaattgaagagaaaataacatatctgctcatgaacgaggatgagtttaag
agaaagttcggaagcttggagaagattacagaagttaaagcaaaaaacgtaattgtgaca
ttaaatggaggaggtgctttagttagagatgaaagtaagaatgtctttgaagtaagaggc
ttgagtgccgaagttatagattctacaggtgctggagattcctttgatgctggacttatt
tatggagtcctcaacggctggagcttaaaggatgctgcaaagcttggaatgttattagct
tatctgactgttcagaaagtcggtgcaaggagtgccgtggttcctcttgaagagataaag
aagaaagcaaaagaattaaacctcaacctgcctttctag

DBGET integrated database retrieval system