KEGG   Thermococcus sp. ES1: TES1_1749Help
Entry
TES1_1749         CDS       T03005                                 

Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ths  Thermococcus sp. ES1
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ths00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TES1_1749
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TES1_1749
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TES1_1749
   00680 Methane metabolism
    TES1_1749
Enzymes [BR:ths01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TES1_1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(1667073..1668503)
Genome map
AA seq 476 aa AA seqDB search
MIPRTMSTQHPDNVYIPFFAQEPQLSGEDEIIEAFYAFSVLGIEEQMWDFEGKEVDEFVV
KKLLERYPHFFRKHKLGRDFRLTPRVPNPSVEKAEAKLLLETLESIPRSADYSKIFYEEE
TAPIFEVILPMTTSANEINRVYELYKRYIVGKQYKRIYDIKLYEWIGEFFPGEINVIPLF
ETKEAILNSAEILREYLYGKDFEYQRVFLARSDPAMNYGLLSAVIYDKYALFKLQKLEDE
ESVDIYPIIGVGSAPFRGHLVPENVDNVLEEYRGAQTFTIQSSFKYDNPPKEVIKAVEKI
KSSKRKEAEPIDEQILSILRKYEIEYSKQIKALAMLIREVAKFVPSRRKRKLHIGLFGYA
RDVNGFALPRAIKFTASLYSLGIPPEVLGLNALSEKDIEVVGEVYKGIYKDLSFAFSYFN
PKSAEKFKFLRDILKMSQLFEFERNEEHCEITSKILHGEINEELIIKAASIRGFLG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgataccaagaactatgagcactcaacatcctgacaatgtgtatatacctttctttgct
caggagcctcaattaagtggtgaggatgaaataattgaagcgttttatgctttcagtgtt
ctaggaatagaagaacaaatgtgggacttcgaaggaaaagaggttgacgagtttgttgtt
aaaaagcttctggagagataccctcacttcttccgaaagcacaagcttggaagggatttt
aggttaactccaagagtcccaaatccaagtgttgagaaagccgaagcaaagcttttgctt
gaaacactcgaaagtattccccgttcagctgattattcgaagatattttacgaagaggag
actgctccgatatttgaagttatccttccaatgacaacttcagcaaacgaaattaacaga
gtctacgagctgtacaaacgttatattgttggaaagcagtacaagaggatctacgacata
aagctctacgagtggattggggaattctttcctggggagattaatgtaatacctctcttt
gaaacaaaagaggcaatactaaactcagctgaaatattgagagagtacttgtatgggaag
gactttgaataccagcgtgttttcctggcaagaagtgatcctgccatgaactatggcctg
ttaagcgccgttatctatgataaatatgctctctttaagcttcagaagcttgaagatgag
gagagtgttgatatttatccgataattggtgttggcagtgcgccttttagaggtcatctt
gtccctgaaaatgttgacaatgttctggaagagtatagaggggctcagacgtttacaatt
caaagttcatttaagtatgataatccaccaaaggaagtcataaaagccgttgagaaaatt
aaaagctcaaagagaaaagaagctgagccaattgatgagcaaatcctctcaattctccga
aaatatgaaattgaatattccaagcagattaaagctttggcaatgttgataagagaggtt
gctaagtttgttccctctaggagaaagagaaagctccacattggactatttggttatgct
agggacgttaatggttttgcacttccaagagcaataaagttcactgcatctctttattcc
cttggcatacctccagaggttcttggattaaatgcacttagcgaaaaggacattgaagtt
gtgggagaagtttacaagggcatttacaaagatttaagcttcgcattcagttatttcaac
cctaaatcagctgagaaatttaaattcctaagggacattctgaaaatgagccaattgttt
gaatttgagagaaatgaggaacactgtgaaattacaagcaaaatcttgcatggtgagatt
aatgaagagttaataatcaaagcagcgagcattaggggattcttggggtga

DBGET integrated database retrieval system