KEGG   Thermococcus sp. ES1: TES1_1998Help
Entry
TES1_1998         CDS       T03005                                 

Definition
alkaline phosphatase IV precursor
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ths  Thermococcus sp. ES1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ths00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TES1_1998
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    TES1_1998
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TES1_1998
Enzymes [BR:ths01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     TES1_1998
Exosome [BR:ths04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TES1_1998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1911016..1912506
Genome map
AA seq 496 aa AA seqDB search
MKKVFGLLLIIGLLVFAQAGIATAPATTSTGVKNVILIIGDGMGFAHVQLTKLVYGHLNM
EDFPYTGFELTYSLSGEVTDSAAAATALATGMKTYNGMISTVTNGDKVYNLTTLLELAQF
LGKSTGLVTTTRITHATPAAFGAHVEDRDMEAEIAKQLIEHKINVLFGGGKKKFDDATLE
LAKQYGYEVIFDKEGLEKASGEYVLGLFAYSHIPYVLDRSESDVGLLDMTKKAIELLERN
PNGFFLMIEAGRIDHASHGNDIVATLAETKELDDVVGYVLEYAKKRGDTLVVVTGDHETG
GLAVGINYGSVVDVNKILSIKKSTSFMAAEIKNGGDIKEVVKKYTGIELSDEEVEYIKQM
DQENPIFGLSNALGEIISKKVGVTFASHKHTGEPVPLLAYGPGADNFVGFHHHIQTSKLI
AKLMIFGVPRVNILFEGTSSAKGDLNGDYRVDEKDAYIALMVLLGEKVDSELEERADLDN
NGIIDLHDVMLILQEA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggtatttgggctattgttaattattgggctattggtttttgcccaagcaggg
atagcaacagctccagcgaccacttcaacgggtgtcaaaaatgttatattgattatcggt
gatggtatggggtttgctcatgtgcagcttactaaactagtttacggacatcttaacatg
gaggactttccatatactggatttgagcttacgtattctcttagtggggaggttacagat
tccgctgcagcagctacagcacttgctacgggtatgaagacatacaacggtatgatttca
acagtaactaatggtgataaagtgtataatttaacaacactccttgagcttgctcaattc
ttgggtaagtcaactggacttgttacaactaccagaatcacccatgcaactcctgctgcc
tttggagcccacgttgaagacagagacatggaggcggaaattgcaaagcagctcattgag
cacaagatcaacgttctcttcggtggtgggaagaagaagtttgatgatgcaaccttagaa
ctggcaaagcaatacggttatgaagtaatcttcgacaaggaaggcctagaaaaggcaagc
ggtgaatatgtgcttggattgtttgcatacagccacattccctacgtactcgacaggagc
gagagcgacgttggtctgcttgacatgacgaagaaggccattgagctgttggagagaaat
ccaaacggattcttcttaatgattgaagctggaagaattgatcacgcaagccatggaaac
gacattgtggcaacccttgctgaaactaaagagttggatgatgttgtgggatatgttcta
gagtatgcgaagaagagaggagacacgttagtagtagttacaggtgaccatgaaactgga
ggccttgctgttggaattaactatggaagtgtagttgatgtcaacaagatactcagcatc
aaaaagagtacaagctttatggcagctgaaataaagaatggaggagacattaaagaggtt
gtcaagaaatatacagggatagaattgagcgatgaggaagttgaatacattaaacagatg
gatcaggagaatccaatatttggtttgtccaacgctttgggagagataatttcaaagaaa
gttggagtaacatttgcttcacacaagcatactggagagccagttcctctcttagcatat
gggcctggagcagataactttgtaggattccaccaccatatacagaccagcaagcttatt
gcaaagcttatgatctttggcgtaccaagagtcaatattctatttgagggaacaagctct
gcaaagggagacctaaatggcgattacagagttgacgagaaagatgcgtatattgcctta
atggtgctcttaggagaaaaagttgacagcgagctagaggaaagggcagacttggataac
aacggaatcatagacctccatgatgtaatgttaattctccaggaagcataa

DBGET integrated database retrieval system