KEGG   Thermoanaerobacter sp. X513: Thet_0036Help
Entry
Thet_0036         CDS       T01317                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:thx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Thet_0036
DNA repair and recombination proteins [BR:thx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Thet_0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
39781..40380
Genome map
AA seq 199 aa AA seqDB search
MNYYSTSIAKLIEELSKLPGVGPKTAQRLAFFIINMPLEEVKSLSQAIIDAKEKIKYCRI
CYNITDTEVCNICSDKERDHSLICVVSHPMDVVAMEKIREYKGVYHVLHGVISPIEGVGP
EDIKIKELLDRVKNGNVKEVILATNPDIEGEATAMYIAKLLKPLGIKVTRIAHGVPVGGD
LEYTDVVTLSRALEGRREL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaactattattctacttctatagcgaagcttatagaagaactgtcaaagttgcctggt
gtaggccctaaaacagcacaaaggcttgcttttttcataataaacatgcctttagaagag
gtaaaaagcttgtctcaagcgattattgatgcaaaagaaaagataaagtattgtagaatt
tgttataacataactgacacagaggtttgtaacatatgtagtgataaagaaagagatcat
tctcttatatgtgttgtttctcatcctatggatgttgtcgcaatggagaaaatacgagaa
tataaaggagtgtatcatgtacttcatggtgttatttctccgatagaaggcgttggccct
gaagatataaaaattaaagaacttttagacagagtaaaaaatggaaatgtaaaagaagtc
atacttgctacaaatcctgacatagagggagaagcgacagcaatgtacattgctaagcta
ttaaaaccgttaggaataaaagtcacaaggattgctcatggggtgccggtaggcggtgac
ctggaatacaccgatgttgtaactctttcaagggctcttgaaggtagaagggaattgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system