KEGG   Thermoanaerobacter sp. X513: Thet_0189Help
Entry
Thet_0189         CDS       T01317                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:thx00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:thx00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
190484..191800
Genome map
AA seq 438 aa AA seqDB search
MEYFKNVPQIKYEGPKSNNPYAFKFYNPDEIIDGKPLKEHLRFSVAYWHTFTANGTDPFG
APTMQRPWDHFTDPMDIAKARVEAAFELFEKLDVPFFCFHDRDIAPEGETLRETNKNLDT
IVAMIKDYLKTSKTKVLWGTANLFSNPRFVHGAATSCNADVFAYAAAQVKKALEITKELG
GQNYVFWGGREGYETLLNTDMELELDNLARFLHMAVEYAQEIGFEGQFLIEPKPKEPTKH
QYDFDAASVHAFLKKYDLDKYFKLNIEANHATLAGHDFQHELRYARINNILGSIDANMGD
MLLGWDTDQYPTDIRMTTLAMYEVIKMGGFNKGGLNFDAKVRRASFEPEDLFLGHIAGMD
AFAKGFKVAYKLVKDGVFDRFIEERYKSYREGIGAEIVSGKANFKTLEEYALNNPKIENK
SGKQELLESILNQYLFSE
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggaatacttcaaaaatgtaccacaaataaaatatgaaggaccaaaatcaaacaatcca
tatgcatttaaattttacaatccagatgaaataatagacggaaaacctttaaaagaacac
ttgcgtttttcagtagcgtactggcacacatttacagctaatgggacagatccatttgga
gcacctacaatgcaaaggccatgggaccattttactgaccctatggatattgccaaagcg
agagtagaagcagcctttgaactatttgaaaaactcgacgtaccatttttctgtttccat
gacagagatatagctccggaaggagagacattaagggagacgaacaaaaatttagataca
atagttgcaatgataaaagactacttaaagacgagcaaaacaaaagtattatggggtaca
gcgaaccttttttcaaatccgagatttgtacatggagcagctacttcctgtaatgcagat
gtatttgcatatgcagcagcgcaagtaaaaaaagcccttgagataacaaaagaacttgga
ggacagaactatgtattttggggtggaagagaaggatatgaaacattacttaacacagat
atggaattggaacttgataacttagcaagatttttgcacatggcagtagaatatgcacaa
gagataggatttgaagggcagtttttaattgagccaaaacctaaagaaccgacaaaacac
caatatgattttgatgcagcaagtgtacatgcatttttaaagaagtacgaccttgataaa
tacttcaaattaaacatagaagcgaaccatgcgacacttgcaggacatgactttcaacat
gaattaagatatgcaaggattaacaacatattaggctctatagatgcaaatatgggagat
atgcttttaggatgggatacagaccaatatccaacagacatacgaatgacaacccttgcg
atgtacgaagtcataaagatgggaggttttaacaaaggtggacttaacttcgatgcgaaa
gtaaggcgtgcctcctttgagccagaagatttatttttagggcatatagcgggtatggat
gcatttgcaaaaggattcaaagtagcctataagcttgttaaagatggtgtatttgataga
tttatagaagaaagatacaaaagttatcgagaaggcataggagcagagatagtaagtggg
aaagcgaattttaaaactcttgaagaatacgcattaaacaatccaaaaattgagaacaaa
tcaggcaagcaggaactactggagtcaatattaaatcagtatttatttagtgaatga

DBGET integrated database retrieval system