KEGG   Thermoanaerobacter sp. X513: Thet_0220Help
Entry
Thet_0220         CDS       T01317                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase (EC:3.2.1.52)
  KO
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Amino sugar and nucleotide sugar metabolism
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Thet_0220
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Thet_0220
Enzymes [BR:thx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Thet_0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
224002..225579
Genome map
AA seq 525 aa AA seqDB search
MGIKDMTLEEKIGQMLMVGFPSPTYDDHVEKLVSEYKIGNIILFSRNVKGKEQLQNLCNN
IQMNIIKHTGIPALVAIDQEGGMVTRIYKDATYLPGNMAIAATNEVENAYKIGEIAGKEL
RALGININFAPVLDINNNLSNPVIGVRSYGENPEKVAEFGINYIKGLQKENVIATAKHFP
GHGDTSVDSHLDLPLVSYNKERLYRIELYPFKKAIENGVEAIMTAHILFSALEENKLPAT
LSHNILTNILRKELRFNGLIITDCMEMNAIAKYFGTAKAAAMAIKAGADIVLVSHTKKLQ
IEAFNEIKEAVLRGEISIERIDESVERIIQLKEKYKLFENPYPDENKIKTIVGCKEHQEI
AKNISLNSITIVKDENNLLPIRKQKILAVSPETVPISGVDDTLMDKVSFAKAFVQKFGGV
EKTIPVNPDEDLINTIREEAKDKEIVVVGAYNASLNEGQVRLVNSLLEVNKNIIVVALRN
PYDLLEFEDVPTYVCTYEYTPLSVESVLEVLSGNYVPKGELPVSL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggggattaaggatatgacactggaagaaaagatagggcaaatgctgatggttggcttt
ccgtcgcccacctatgatgaccatgttgagaagttagttagtgaatataaaattggtaac
ataattttattttctagaaatgtaaagggaaaagaacagcttcaaaatttatgcaataat
atccagatgaacataataaaacatacaggcattccagcgttagttgctattgaccaggag
ggaggaatggttacaagaatttataaagatgccacttatttaccaggcaatatggcaata
gcagcgacaaatgaagtagaaaatgcatataagataggagaaatagcaggtaaagagctt
agagcattgggcataaatattaattttgctcctgtccttgatattaataataatctatct
aatcctgtaataggggttaggtcttatggagaaaatccagaaaaagtagcggagttcgga
attaattatataaaaggtttacaaaaagaaaatgttatagcgacagcgaagcattttccc
ggtcatggggatacttcagtagattctcatcttgatttaccattggtgtcttacaataaa
gagcgattatatagaattgagttatatccttttaaaaaagcaatagaaaatggtgtggaa
gccataatgacagcccatattctcttttcagctcttgaggaaaataaattgcctgcaaca
ttgtcccataatattctcaccaatatactgagaaaggaacttagatttaatggattaatt
ataactgattgtatggaaatgaatgcaattgcaaaatattttggtacggccaaagcagct
gcgatggccataaaagcaggagcagatatagtccttgtttcccatacgaaaaaactgcag
atagaggcatttaatgaaatcaaagaggcagttttacgaggtgaaatatcaattgaaaga
atagatgaatctgttgaaagaataatccaattaaaagagaaatacaaactttttgaaaat
ccatatccagatgaaaataaaattaaaactattgtggggtgtaaagaacatcaagaaatt
gcaaaaaacataagtttgaatagcatcactattgttaaagacgaaaataaccttttacca
ataaggaaacaaaaaatattggcagtttctcctgaaacagtcccaatttcaggtgtggat
gatactttaatggataaagtatcttttgcaaaagcttttgtgcaaaaatttggaggggtt
gaaaaaactattcctgtaaatcctgatgaagacctcataaatactatcagagaagaggct
aaagataaagaaattgttgtagtaggcgcttataatgctagtttgaatgaaggccaagta
aggcttgtaaactcattgctggaagtgaataaaaatatcatcgttgttgccttaagaaat
ccatatgatttattagaatttgaagatgtgcctacatatgtttgtacttatgaatatact
ccactttctgtagaaagtgtgctagaggttttaagtggtaattatgtgccaaaaggagaa
ttgccggtttctttataa

DBGET integrated database retrieval system