KEGG   Thermoanaerobacter sp. X513: Thet_0220Help
Entry
Thet_0220         CDS       T01317                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:thx00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:thx00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
224002..225579
Genome map
AA seq 525 aa AA seqDB search
MGIKDMTLEEKIGQMLMVGFPSPTYDDHVEKLVSEYKIGNIILFSRNVKGKEQLQNLCNN
IQMNIIKHTGIPALVAIDQEGGMVTRIYKDATYLPGNMAIAATNEVENAYKIGEIAGKEL
RALGININFAPVLDINNNLSNPVIGVRSYGENPEKVAEFGINYIKGLQKENVIATAKHFP
GHGDTSVDSHLDLPLVSYNKERLYRIELYPFKKAIENGVEAIMTAHILFSALEENKLPAT
LSHNILTNILRKELRFNGLIITDCMEMNAIAKYFGTAKAAAMAIKAGADIVLVSHTKKLQ
IEAFNEIKEAVLRGEISIERIDESVERIIQLKEKYKLFENPYPDENKIKTIVGCKEHQEI
AKNISLNSITIVKDENNLLPIRKQKILAVSPETVPISGVDDTLMDKVSFAKAFVQKFGGV
EKTIPVNPDEDLINTIREEAKDKEIVVVGAYNASLNEGQVRLVNSLLEVNKNIIVVALRN
PYDLLEFEDVPTYVCTYEYTPLSVESVLEVLSGNYVPKGELPVSL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggggattaaggatatgacactggaagaaaagatagggcaaatgctgatggttggcttt
ccgtcgcccacctatgatgaccatgttgagaagttagttagtgaatataaaattggtaac
ataattttattttctagaaatgtaaagggaaaagaacagcttcaaaatttatgcaataat
atccagatgaacataataaaacatacaggcattccagcgttagttgctattgaccaggag
ggaggaatggttacaagaatttataaagatgccacttatttaccaggcaatatggcaata
gcagcgacaaatgaagtagaaaatgcatataagataggagaaatagcaggtaaagagctt
agagcattgggcataaatattaattttgctcctgtccttgatattaataataatctatct
aatcctgtaataggggttaggtcttatggagaaaatccagaaaaagtagcggagttcgga
attaattatataaaaggtttacaaaaagaaaatgttatagcgacagcgaagcattttccc
ggtcatggggatacttcagtagattctcatcttgatttaccattggtgtcttacaataaa
gagcgattatatagaattgagttatatccttttaaaaaagcaatagaaaatggtgtggaa
gccataatgacagcccatattctcttttcagctcttgaggaaaataaattgcctgcaaca
ttgtcccataatattctcaccaatatactgagaaaggaacttagatttaatggattaatt
ataactgattgtatggaaatgaatgcaattgcaaaatattttggtacggccaaagcagct
gcgatggccataaaagcaggagcagatatagtccttgtttcccatacgaaaaaactgcag
atagaggcatttaatgaaatcaaagaggcagttttacgaggtgaaatatcaattgaaaga
atagatgaatctgttgaaagaataatccaattaaaagagaaatacaaactttttgaaaat
ccatatccagatgaaaataaaattaaaactattgtggggtgtaaagaacatcaagaaatt
gcaaaaaacataagtttgaatagcatcactattgttaaagacgaaaataaccttttacca
ataaggaaacaaaaaatattggcagtttctcctgaaacagtcccaatttcaggtgtggat
gatactttaatggataaagtatcttttgcaaaagcttttgtgcaaaaatttggaggggtt
gaaaaaactattcctgtaaatcctgatgaagacctcataaatactatcagagaagaggct
aaagataaagaaattgttgtagtaggcgcttataatgctagtttgaatgaaggccaagta
aggcttgtaaactcattgctggaagtgaataaaaatatcatcgttgttgccttaagaaat
ccatatgatttattagaatttgaagatgtgcctacatatgtttgtacttatgaatatact
ccactttctgtagaaagtgtgctagaggttttaagtggtaattatgtgccaaaaggagaa
ttgccggtttctttataa

DBGET integrated database retrieval system