KEGG   Thermoanaerobacter sp. X513: Thet_0362Help
Entry
Thet_0362         CDS       T01317                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thet_0362
Enzymes [BR:thx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Thet_0362
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Thet_0362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
374084..375577
Genome map
AA seq 497 aa AA seqDB search
MSGIVYLIGAGPGDIGLLTLRAVELIKNADVLVYDRLINEDILKMAKKDAELIDVGKFPD
NHKVPQSKINEIIAKKALSGKKVARIKGGDPFVFGRGGEEAEYLTQKRIPYEVVPGITSA
VAVLSYAGIPVTHRDLSSSFHVITGHEWKGKDKKLDWEVISKLDGTLVFLMGIKNIEKIV
KKLLNYGKDPHTPAAVIMEGTTPNQKVVTAKLIDISSLVRKEGIKNPGVFAVGDVVTLRD
RLKWYENKKLFGKRILLTRTYEQSQQMKKILSEEGADVVVCPTIKITPFLNNIVKFLEEI
HKFDYAVFTSVNDVWSFIEASREKRVDLRNLRIKVVAIGSKTAEALENIFIYPDIIPEEY
TSYSLANALKKHVEGKNIALLTSQIGGDILLESLGNCANVQKIVAYKNEPNYEIKEKLIS
ELRKGIDIAVFTSSSTFNYMHQLIGDEINLLKNSKIAAIGPVTKKAIEDKGFNVDIMPSE
YTTEKLIEEILKNYQNQ
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggattgtatatttgatcggagcaggacctggagatattgggcttttaacattg
agagcagtcgaactaataaaaaatgcagatgtgctggtgtatgacaggctcattaatgaa
gatattttaaaaatggcaaaaaaggatgcagagcttattgatgttggaaagtttccggat
aatcacaaagtacctcaaagtaaaataaatgaaataattgcgaaaaaggccctttctggc
aaaaaagtagcaagaattaaaggaggagacccttttgtattcggaagaggtggcgaagaa
gcggaatatcttacacaaaaaagaataccttatgaggtagtgccaggcataacatctgca
gtggctgtcctatcctatgcaggaattcctgtaacccatagagatttaagttcgtcattt
cacgtaataacgggtcatgaatggaaagggaaagataaaaaactcgattgggaggtcata
tcaaaactcgatgggacacttgtatttctcatggggataaaaaatatagaaaaaattgtg
aaaaaacttctcaattacggcaaagaccctcatacaccggcagcagtaataatggaaggt
actactccaaaccaaaaagttgtgactgcaaaactcattgatatttcaagtcttgtacga
aaagaaggaataaaaaatccgggagtttttgctgtaggagatgttgtaacattaagggac
agattaaaatggtatgaaaacaaaaagctttttgggaaaaggattttgcttacaaggacc
tatgaacaatcacagcagatgaaaaaaattttgagtgaagagggagcagatgttgttgtt
tgtcctactattaaaatcacgccgtttttaaataatatagtaaagtttttagaagaaata
cataaattcgattatgctgtatttacaagtgtaaatgacgtttggagttttattgaagct
tcccgagaaaaaagggttgatttaagaaatttaagaattaaagtagtagcgataggaagt
aaaactgcggaagctttagaaaatatttttatatatccagatataattcctgaggagtac
acctcatactctttagcaaatgcacttaaaaaacatgttgaaggaaaaaacatagcgctt
ttgacttctcagataggcggggatatattgctggaaagtctaggaaattgtgctaacgta
caaaaaattgtcgcatataaaaatgaaccaaattatgaaataaaggaaaagcttataagt
gaactccgcaaaggaatagatattgctgtatttacaagttcctctacctttaattatatg
catcaattaataggagacgaaataaatcttctaaaaaactctaaaatagctgcaatagga
cctgtaacaaagaaagctatagaggataaaggatttaatgtagacataatgccaagtgaa
tacacaacggaaaaacttattgaagaaatattaaaaaactatcaaaaccaatag

DBGET integrated database retrieval system