KEGG   Thermoanaerobacter sp. X513: Thet_0363Help
Entry
Thet_0363         CDS       T01317                                 

Definition
Porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thet_0363
Enzymes [BR:thx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Thet_0363
Exosome [BR:thx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thet_0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
375592..376566
Genome map
AA seq 324 aa AA seqDB search
MDLVKRPRRLRMNSILREMIRETSLDVGDLIYPLFVVPGDNIKEEIDSMPGVYHFSIDLL
VEEVKEVRDLGIPAILLFGVPSYKDELGSEAYSEEGIVQKAVREIKEKVPEIVVITDVCM
CGYTIHGHCGIVENGQVVNDKTIDYIAKIALSHVEAGADIVAPSDMMDGRVAAIRKLLDS
KGFVNTPIMAYSAKYASSFYGPFREAANSFPQFGDRKSYQMDYGNSNEALREIALDIEEG
ADIVMVKPALSYLDIIRRVKDNFNIPIAAYNVSGEYSMVKAAAKMGWIDEKSVVLEILTS
IKRAGADIVITYFAKDVAKWFITL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggatttggtaaaaaggccaagaaggcttaggatgaacagtattttaagggagatgata
cgagaaacttctttagatgttggtgaccttatatatcctctttttgttgtgccaggagat
aatataaaagaagagatagattcaatgccgggtgtttaccatttttctatagatttgctt
gtagaagaagttaaagaagtgcgtgaccttggaattcctgctattttactttttggtgtg
ccttcatataaagatgaattagggtcagaggcttatagtgaggaaggcatcgttcaaaaa
gcggtgagagaaataaaagaaaaagtgcctgaaattgtggtaataacagatgtgtgtatg
tgtgggtatacaattcatggtcactgtggaattgttgaaaatggacaagttgtaaatgac
aaaacgatagattacatcgctaaaatagccttgtcccatgttgaggcaggggcggatatt
gtagcgccttctgacatgatggatggaagagtagctgccataagaaagcttttagatagt
aaaggatttgtaaacacacctattatggcttacagtgctaaatacgcttcctctttttat
ggaccttttagagaagcagcaaattctttcccacaatttggcgacagaaagtcttatcaa
atggactatggaaactccaacgaagccttaagagaaatagctcttgacattgaagaagga
gcagatattgtcatggtaaagccggcactttcttatcttgatattataaggcgggtaaag
gataatttcaacattcctattgctgcttataatgtaagtggagaatattcaatggtaaag
gcggcagctaagatgggttggattgatgaaaaatcggtagtcttagaaatactcacttca
attaaaagggcaggggcagacatagttataacctactttgcaaaggatgttgcaaaatgg
tttattaccctataa

DBGET integrated database retrieval system