KEGG   Thermoanaerobacter sp. X513: Thet_0423Help
Entry
Thet_0423         CDS       T01317                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:thx00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
423668..424708
Genome map
AA seq 346 aa AA seqDB search
MDYKDLLKKLSESYGVSGHERGIYDLLKKEFEPISDEVKEDNFGNLIFKKKGTKGKYKVM
LAAHLDEIGLMVKDIDEKGFIKFTTVGGVDQRTLPSQEVIVHGKKDLLGVIGSKPPHLLS
SEDMEKAIKIDDMYVDVGLPKKEVEELVKIGDIITIKRDFRELLNDYVSGKALDDRAGIV
VMAVCLDELKKLYHYHDVYAVVTLQEEVGVRGATTSAYNVEPDIAIAIDVTHGKARGVSL
EIELGKGPAIGKGPNIHPAVYKGLVEAAKNYNINYQVEPLPGPSGTDAWAIQVSREGVPT
GLVSIPLRYMHTSVETANMKDVISSGKLLAYYIANLPEELEGHLCY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggattataaggatttattaaaaaagcttagtgaaagctacggggtttctgggcatgag
agaggaatttatgacctcttaaaaaaagaatttgaaccaatttcagatgaagttaaagaa
gacaattttggcaatcttatttttaaaaagaagggcacaaaaggcaagtacaaggtgatg
ttagcagctcatttagatgaaataggccttatggtgaaagatattgatgagaaaggattt
ataaaatttacaacagtaggaggggttgatcagaggactcttccttcccaagaagttata
gttcacggtaaaaaggatttgttgggagttataggaagtaagccaccacatcttttgtct
tctgaggacatggaaaaagctataaaaatagatgatatgtatgtggatgttggacttcct
aaaaaagaagtagaggaattagtcaaaattggcgacattataacgataaaaagagacttc
agagagcttttaaatgattatgtttctggaaaggccttagatgatagagccgggattgtt
gtgatggcagtatgccttgatgaactgaaaaaattatatcattatcatgatgtatatgca
gtagttacacttcaggaagaagtaggagtaagaggagctacaacttccgcttataatgta
gagccagacattgcaattgctattgacgttacccatggaaaagcaagaggggttagtctg
gagatagagttaggtaaaggacctgcaattggaaaaggacctaatattcatccggcagta
tacaaaggacttgttgaggctgcaaagaattacaatataaactatcaagtagagccgctt
ccaggtccatcaggaacagacgcttgggcgatacaggtttcaagagagggcgtgccaaca
ggattagtatcaatacctctaaggtatatgcatacttcagtagaaactgcaaatatgaaa
gatgtaataagtagtggtaaactcttagcttattatatagccaatcttccagaggaattg
gagggacacttatgttattaa

DBGET integrated database retrieval system