KEGG   Thermoanaerobacter sp. X513: Thet_0423Help
Entry
Thet_0423         CDS       T01317                                 

Definition
(GenBank) peptidase M42 family protein
Organism
thx  Thermoanaerobacter sp. X513
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
423668..424708
Genome map
AA seq 346 aa AA seqDB search
MDYKDLLKKLSESYGVSGHERGIYDLLKKEFEPISDEVKEDNFGNLIFKKKGTKGKYKVM
LAAHLDEIGLMVKDIDEKGFIKFTTVGGVDQRTLPSQEVIVHGKKDLLGVIGSKPPHLLS
SEDMEKAIKIDDMYVDVGLPKKEVEELVKIGDIITIKRDFRELLNDYVSGKALDDRAGIV
VMAVCLDELKKLYHYHDVYAVVTLQEEVGVRGATTSAYNVEPDIAIAIDVTHGKARGVSL
EIELGKGPAIGKGPNIHPAVYKGLVEAAKNYNINYQVEPLPGPSGTDAWAIQVSREGVPT
GLVSIPLRYMHTSVETANMKDVISSGKLLAYYIANLPEELEGHLCY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggattataaggatttattaaaaaagcttagtgaaagctacggggtttctgggcatgag
agaggaatttatgacctcttaaaaaaagaatttgaaccaatttcagatgaagttaaagaa
gacaattttggcaatcttatttttaaaaagaagggcacaaaaggcaagtacaaggtgatg
ttagcagctcatttagatgaaataggccttatggtgaaagatattgatgagaaaggattt
ataaaatttacaacagtaggaggggttgatcagaggactcttccttcccaagaagttata
gttcacggtaaaaaggatttgttgggagttataggaagtaagccaccacatcttttgtct
tctgaggacatggaaaaagctataaaaatagatgatatgtatgtggatgttggacttcct
aaaaaagaagtagaggaattagtcaaaattggcgacattataacgataaaaagagacttc
agagagcttttaaatgattatgtttctggaaaggccttagatgatagagccgggattgtt
gtgatggcagtatgccttgatgaactgaaaaaattatatcattatcatgatgtatatgca
gtagttacacttcaggaagaagtaggagtaagaggagctacaacttccgcttataatgta
gagccagacattgcaattgctattgacgttacccatggaaaagcaagaggggttagtctg
gagatagagttaggtaaaggacctgcaattggaaaaggacctaatattcatccggcagta
tacaaaggacttgttgaggctgcaaagaattacaatataaactatcaagtagagccgctt
ccaggtccatcaggaacagacgcttgggcgatacaggtttcaagagagggcgtgccaaca
ggattagtatcaatacctctaaggtatatgcatacttcagtagaaactgcaaatatgaaa
gatgtaataagtagtggtaaactcttagcttattatatagccaatcttccagaggaattg
gagggacacttatgttattaa

DBGET integrated database retrieval system