KEGG   Thermoanaerobacter sp. X513: Thet_0424Help
Entry
Thet_0424         CDS       T01317                                 

Definition
Cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Thet_0424
Enzymes [BR:thx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Thet_0424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
424699..425721
Genome map
AA seq 340 aa AA seqDB search
MLLKELTEIMGASGDEKEIREKIKSIVEPYVDNVYVDKIGNLIACKKGKKDKPKIMLAAH
MDEVGLMVKSVNEDGTLSFFPVGGVDNRILVAKTVKVGEKGINGVIGAKPIHLQKRDEQQ
KPLDFDSLYIDIGATSKEEALKHVSPGDYVYFDSNFEILGNGYVKAKALDDRIGCNVLIE
NLKNEYEYTVCAAFTVEEEVGLRGAGVAAYNVEPDFAIIVEGTVAADVTDSVPHLVSTEL
GKGPAISLMDRTTLYDKKLIDKIAKIADENKVPYQFRRIASGGNDAGKIHLTKGGIKTIA
VSVPCRYIHSFNSVAFLEDFNNTVKLVDLIIKNIEKEALI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaaggaattgacagaaataatgggggcttcaggagatgagaaggagataagg
gagaagataaaaagtattgttgaaccatatgtggacaatgtttatgtagataaaataggg
aatttgatagcctgcaaaaaaggcaaaaaagacaaacctaaaataatgttagctgcccat
atggatgaagtaggacttatggtaaaatcagttaatgaagatgggactttgagttttttt
cctgtaggtggtgtagataatagaatactcgttgcaaaaacagtaaaagtaggtgaaaag
ggaataaatggagtaataggagcaaagccaatacaccttcaaaagagagacgaacagcaa
aagcctcttgacttcgattctctttatatagacattggtgcgacttcaaaagaagaagct
ttaaaacatgtttcccctggagattatgtttattttgactcaaattttgagatattagga
aatggctatgtgaaagcgaaggctttggatgacagaataggctgtaatgtgctgatagaa
aatctgaaaaacgagtatgaatatactgtttgtgcagcttttacagtggaggaggaagta
ggtttaaggggagcaggtgttgcagcatataatgtggaacccgactttgccataattgtg
gaagggacagttgcagcggatgttactgattcagtaccccatttagtttctacggaattg
ggcaagggacctgcaatttctttgatggacaggacaactctttatgataaaaaacttatt
gataaaattgcgaaaatagccgatgagaataaggtaccttatcaatttaggagaatagcc
agcggcggcaatgatgcagggaaaatccatcttacaaaaggtggcataaaaacaattgct
gtatctgtcccctgcaggtatattcattcttttaattctgtagcctttttagaagatttt
aataacacagttaaattggttgatttgataatcaaaaatattgaaaaggaggctttaata
tga

DBGET integrated database retrieval system