KEGG   Thermoanaerobacter sp. X513: Thet_0424Help
Entry
Thet_0424         CDS       T01317                                 

Definition
(GenBank) Cellulase
Organism
thx  Thermoanaerobacter sp. X513
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
424699..425721
Genome map
AA seq 340 aa AA seqDB search
MLLKELTEIMGASGDEKEIREKIKSIVEPYVDNVYVDKIGNLIACKKGKKDKPKIMLAAH
MDEVGLMVKSVNEDGTLSFFPVGGVDNRILVAKTVKVGEKGINGVIGAKPIHLQKRDEQQ
KPLDFDSLYIDIGATSKEEALKHVSPGDYVYFDSNFEILGNGYVKAKALDDRIGCNVLIE
NLKNEYEYTVCAAFTVEEEVGLRGAGVAAYNVEPDFAIIVEGTVAADVTDSVPHLVSTEL
GKGPAISLMDRTTLYDKKLIDKIAKIADENKVPYQFRRIASGGNDAGKIHLTKGGIKTIA
VSVPCRYIHSFNSVAFLEDFNNTVKLVDLIIKNIEKEALI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaaggaattgacagaaataatgggggcttcaggagatgagaaggagataagg
gagaagataaaaagtattgttgaaccatatgtggacaatgtttatgtagataaaataggg
aatttgatagcctgcaaaaaaggcaaaaaagacaaacctaaaataatgttagctgcccat
atggatgaagtaggacttatggtaaaatcagttaatgaagatgggactttgagttttttt
cctgtaggtggtgtagataatagaatactcgttgcaaaaacagtaaaagtaggtgaaaag
ggaataaatggagtaataggagcaaagccaatacaccttcaaaagagagacgaacagcaa
aagcctcttgacttcgattctctttatatagacattggtgcgacttcaaaagaagaagct
ttaaaacatgtttcccctggagattatgtttattttgactcaaattttgagatattagga
aatggctatgtgaaagcgaaggctttggatgacagaataggctgtaatgtgctgatagaa
aatctgaaaaacgagtatgaatatactgtttgtgcagcttttacagtggaggaggaagta
ggtttaaggggagcaggtgttgcagcatataatgtggaacccgactttgccataattgtg
gaagggacagttgcagcggatgttactgattcagtaccccatttagtttctacggaattg
ggcaagggacctgcaatttctttgatggacaggacaactctttatgataaaaaacttatt
gataaaattgcgaaaatagccgatgagaataaggtaccttatcaatttaggagaatagcc
agcggcggcaatgatgcagggaaaatccatcttacaaaaggtggcataaaaacaattgct
gtatctgtcccctgcaggtatattcattcttttaattctgtagcctttttagaagatttt
aataacacagttaaattggttgatttgataatcaaaaatattgaaaaggaggctttaata
tga

DBGET integrated database retrieval system