KEGG   Thermoanaerobacter sp. X513: Thet_0425Help
Entry
Thet_0425         CDS       T01317                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Thet_0425
Enzymes [BR:thx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Thet_0425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
425718..426701
Genome map
AA seq 327 aa AA seqDB search
MSLNIELIKKLTQTYGPSGNEDKVLEIIKAEVKDFCDDITYDALGNMICKKAGKGKKIMV
AAHTDEIGLMVTHIEDEGFLRFTTIGGVFVEQTIGRRVIFKNGVQGVIGVEHLEDKKEIK
TEKLYIDIGAKNKEEAQKYVNIGDSAAFAGEFIESGDRLISKAFDDRIGCYVAIEVLKNL
KTKNEVYFVFTVQEEVGTRGAAAAAYNIHPDFAVAVDVTSTGDTPKAKKMAVSLGKGAAI
KVMDRSIIVSPSVREMMIEIAQKHNIPYQLEILEFGGTDAGPIHLTKGGIPAGVISIPTR
YVHSVSEMVDKNDVEASIELLKKVLEK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaaatatagaattgataaaaaaacttacacaaacttatggaccctcaggaaat
gaggataaagtgcttgaaattataaaagcggaagtaaaggatttttgtgatgatataact
tatgacgctttgggaaatatgatatgcaaaaaagctggaaaaggaaaaaagataatggta
gctgctcatacggatgaaatagggcttatggttacacacatagaagatgagggtttctta
aggtttactactatagggggagtttttgtagagcagacaataggaagaagagtaattttt
aaaaatggagtgcaaggagttataggagtagagcatttagaggataaaaaagagataaag
actgaaaagttgtatatagacattggagcgaaaaataaagaagaggctcaaaaatatgta
aatataggtgatagtgccgcatttgccggtgagtttattgaatcaggagataggcttatc
tcaaaagcatttgatgatagaataggctgttatgtggcaattgaggtattgaaaaatctt
aagacaaaaaatgaggtatattttgtttttactgttcaagaagaagttggaacaagaggt
gcagctgcagctgcctataacatacatccagattttgctgtagcagttgatgttacatca
actggcgatacacctaaagcgaaaaagatggcagtctctcttggtaaaggggcagctata
aaagtgatggacaggtcaataatagtaagcccttctgtgagggagatgatgattgaaata
gctcaaaaacacaacatcccttatcagctggaaatacttgaatttggtggaactgatgca
gggcctatacatttgacaaaaggcggtataccagctggtgtcatatcaattccgacaagg
tacgtccacagcgtatcagaaatggtagataaaaatgacgttgaggcaagcattgaactt
ttgaaaaaagttcttgagaaatga

DBGET integrated database retrieval system