KEGG   Thermoanaerobacter sp. X513: Thet_0441Help
Entry
Thet_0441         CDS       T01317                                 

Definition
glycoside hydrolase family 4
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Thet_0441
  Lipid metabolism
   00561 Glycerolipid metabolism
    Thet_0441
   00600 Sphingolipid metabolism
    Thet_0441
Enzymes [BR:thx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Thet_0441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(442936..444378)
Genome map
AA seq 480 aa AA seqDB search
MPSVKIGIIGAGSAVFSLRLVSDLCKTPALYGSLVTLMDIDEERLEAVYILAKRYVEEVG
AELKFEKTKNLEDAIIDADFVINTAMVGGHTYLEKVRQISEKYGYYRGIDAQEFNMVSDY
YTFSNYNQLKYFVEIAKKIEKLSPNAWYLQAANPVFEGTTLVTRTSSIKAVGFCHGHLAL
KEVFDTLGLKHNKVDWQVAGVNHGIWLNRFIYEGKSAYEKLNTWIEENSHNWKPLHPFND
QLSSAAIDMYKFHGVLPVGDTVRNASWRYHKNLETKKKWYGEPWCGADSEIGWKWYQETL
GKITDITKKIAKFLIENPKAKFSDIKEIFGQEAKDNELLQEMEKILDPEQKSEEQHIPFV
ESIVTGKKERFVVNIPNRRIIPAVENDVVVEVPAIVDSEGIHPEKIEPMLPERVIKYYLK
PRIMRMEMAVEAFLTGDIDIIKELLYRDPRTQNDGQVEKVLEEILSLPENEEMKKHYLKK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccatcagtaaaaattggtattataggtgcaggaagtgctgtattttctctgaggttg
gtgagcgatttatgcaaaactccagcgttatatggaagcttagtaactctcatggatatc
gatgaagaaagattagaggccgtgtacatacttgcaaaaaggtatgtggaagaagtagga
gcagagttaaagtttgaaaaaactaaaaatttagaagatgccataatagatgcagatttc
gtaataaatacagcaatggtaggaggacatacttatctagaaaaagtcagacagattagc
gaaaaatatggctattatagaggaatagatgcacaggaatttaatatggtttcagattat
tacactttctcaaattacaatcagttgaaatatttcgtagaaattgccaagaaaattgaa
aaactgtctccaaacgcctggtatttacaagctgctaatcccgtatttgaaggcacaact
cttgtaacaaggacctcttcgataaaagcagttggattctgccatggacatcttgcatta
aaagaagtatttgacacactgggacttaagcataataaagtagattggcaagtagcagga
gtaaatcacggaatatggcttaatagatttatatatgaaggaaaaagtgcttacgaaaag
ctcaacacctggatagaggaaaattctcacaactggaaacctcttcatccatttaatgac
cagctatcctcagctgccattgatatgtacaagtttcacggagttttgcctgttggcgat
accgtaagaaatgcttcttggcggtatcataaaaacctggaaacaaagaaaaagtggtat
ggagaaccttggtgtggtgcagactctgaaataggttggaaatggtaccaagaaacatta
ggaaaaattacagacatcactaaaaagattgcaaagttcttgatagaaaatccaaaagca
aagtttagcgatataaaagaaattttcggtcaagaggcaaaagacaatgaattactacag
gaaatggaaaaaatactagacccagagcaaaaaagtgaagaacagcacattcctttcgta
gaatcgattgtaaccggcaaaaaagaaagatttgtagtaaatataccaaatagaagaata
attcctgcagtagaaaatgatgttgttgtagaagtacctgcaatagtagatagcgaagga
atacatccagaaaaaatagaacccatgctcccagagagagtaataaagtattacctaaaa
ccgagaattatgagaatggaaatggcagtagaagcatttttaacaggggacatagacata
ataaaagaacttctgtacagagaccctagaactcaaaatgatgggcaggtagaaaaagtt
ttagaagaaattctatccctaccagaaaatgaagagatgaaaaaacattatttaaaaaaa
tag

DBGET integrated database retrieval system