KEGG   Thermoanaerobacter sp. X513: Thet_0494Help
Entry
Thet_0494         CDS       T01317                                 

Definition
RecD/TraA family helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:thx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Thet_0494
Enzymes [BR:thx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Thet_0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
500668..502875
Genome map
AA seq 735 aa AA seqDB search
MIDIEGVVEEIIFRNEQNGYTVLELSTQGLVVTAVGYMPYVNIGERIKIEGEWVEHPDYG
EQIRVLNYETLAPTTLEGIEKFLSSGLIPGIGPVTARKIVKKFGVDSLNIIETAPERLKE
IKGLSDEKIKRICEAYEMQKGIKEVMVFLQGYGISTAMAIKIYKEYGNNAIEIIKQNPYR
LADDIFGIGFKTADKIAESLGVDPHSLYRISSGTRYVLMQYAANGHTYVPKELLKKEAAS
LLEVSEEEVEDSFVLLVQNEKIHIETFEDDTVGIYYIPYYIAELHTAERLFNMTLMENED
LGIDVQKEIRNFEKETGILLAENQKLAVEEAVKNSVVVITGGPGTGKTTIINCIIRIFEK
AGKKVALAAPTGRAAKRITEATGKEAKTIHRLLEYTYSEEEGKGFNKNEKDPLKYDVIIV
DEASMVDILLMNALLKALPIGAKLILVGDADQLPSVGAGNVLRDIIDSGIVKVIRLKEIF
RQQKQSLIVVNAHKINNGEYPTYNDKNSDFFFINANTQEDILKTILELVTNRLPKAYGFH
PINDIQVLTPMRKGIIGVHNLNLELQKALNPHDKTKAEKIMKEFVFRVGDKVMQIKNNYK
IKWKKGDEEGEGVFNGDIGIIQSIDEELQELTVYFDDEKFVTYDFSDLNELNLSYAITVH
KSQGSEFPVVIMPITYGPPMLLTRNLLYTAVTRAKKLVILVGQEKYLKFMIDNNRISKRY
SGLLSRLKKALLYVN
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgattgacatagagggtgtagttgaagaaataatttttagaaatgaacaaaatggttat
acggttttagaattaagtacccaaggtttagtagtcactgctgtaggttatatgccttat
gtaaacattggggaaagaattaaaattgaaggagaatgggtagaacatcctgattatggt
gagcaaattagggttttaaattatgaaaccttggctcccaccactttagaaggaatagaa
aagtttttatcttctggcttaattcctggaataggtcctgttacagcaagaaaaattgta
aaaaagtttggcgttgattctttaaatataattgaaactgcaccagaaagattaaaagaa
ataaaaggtctaagcgatgagaagataaaaagaatttgtgaagcttatgaaatgcaaaag
ggcataaaagaagtgatggtgtttttgcaggggtacggtatttccactgcaatggctata
aagatttataaagaatacggaaacaacgcgattgaaattattaagcaaaacccttacaga
ttggctgacgatatatttggaataggatttaaaactgcagacaaaatagcagagagccta
ggagttgaccctcattctctatatcgcatatcttctggtactcgatatgttttgatgcag
tatgcggcaaatggtcacacctatgtgccgaaagaattgttaaaaaaagaagcagcaagt
ttgttagaagtgagcgaagaagaagtagaggattcttttgtgcttttagtacaaaatgaa
aaaatacatattgaaacttttgaagatgatactgtaggaatttactatataccttactat
atagctgaattacacacagcagagagattgtttaacatgacactaatggaaaatgaagat
ttaggcatagatgtccaaaaagaaattagaaattttgaaaaagaaacaggtattttgtta
gcagaaaatcaaaaattggctgttgaagaagctgttaaaaattctgttgttgtcataacg
ggaggaccaggcacaggaaagactacaataataaattgtataatacgtatttttgaaaaa
gctggtaaaaaagtggctcttgcagccccaacaggaagagccgcaaaaaggataacggaa
gctactggaaaagaggcgaagactattcataggcttttagaatatacttattcggaggaa
gaagggaagggctttaacaaaaatgaaaaagacccattaaaatacgacgttataatagtt
gacgaagcttcaatggtagatatattgcttatgaatgctttattaaaagccctacctata
ggggcaaaactgattttagtaggggatgctgatcagcttccatctgttggagccggaaat
gtcctaagagatataatagacagtggaatagtaaaagtgatacgtttaaaagaaattttt
agacagcaaaagcaaagtttgatagtagtaaatgctcacaagataaataatggagaatat
ccaacctataacgataaaaatagtgatttcttttttataaatgctaacacccaagaggat
atattaaaaaccatattggagcttgtgacaaacagacttcctaaagcttatggatttcat
cctattaatgatattcaagtactcacccctatgagaaaagggataattggtgttcacaat
ttaaatttagagctgcaaaaagcattaaatccccacgacaaaactaaagccgaaaaaata
atgaaggagtttgtcttcagggtgggggataaagtgatgcaaataaaaaataactacaag
ataaaatggaaaaaaggcgatgaagaaggagaaggagtgtttaacggagatataggaata
attcaatcaatagacgaagaattacaggaattgactgtatattttgacgacgaaaaattt
gtcacttatgacttttctgacttgaatgaactaaatttgtcttatgctataacagtacac
aaaagccaaggcagtgaatttcctgttgtcataatgccaattacttatggaccccctatg
ctattaacaagaaaccttttgtacactgccgttacaagggcgaagaaattggttattttg
gtaggtcaagagaaatatttgaaatttatgattgacaacaatagaatctcaaaaagatat
tcagggcttctttcaaggcttaaaaaagcacttttgtatgtaaactaa

DBGET integrated database retrieval system