KEGG   Thermoanaerobacter sp. X513: Thet_1072Help
Entry
Thet_1072         CDS       T01317                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thet_1072
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thet_1072
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thet_1072
Enzymes [BR:thx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thet_1072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1073763..1074938
Genome map
AA seq 391 aa AA seqDB search
MSGRFGRFGGQYVPETVMNALIELEREFEKAKQDKDFMEEYRYYLREYSGRPTPLYYAEN
LTKKLGGAKIYLKREDLNHTGAHKINNVLGQILLAKRMNKKRVIAETGAGQHGVATATAA
AMFGMECEIFMGEEDIKRQSLNVFRMKLLGAKVTPVKSGTGTLKDAVNEAIRDWVTNIND
TFYVIGSVVGPHPYPTMVRDFQRVIGDEAKEQILQKEGRLPDYVIACVGGGSNAMGIFYP
FIEDKEVKLIGVEAAGEGIETGKHAAAMAKGSVGVLHGMMTYLLQDEEGRIMPVYSISAG
LDYPGVGPEHAFLKESNRAQYVYATDEEALAAFMDLSQTEGIIPALESAHALAYAMKLAP
NLTKDNIIIVNLSGRGDKDVNTVAKVLGVEL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaagatttggacgttttggaggtcagtatgtgccagagactgtgatgaatgcg
cttatagaattagagagggaatttgaaaaagctaaacaggataaagatttcatggaagaa
tataggtattacttgagggaatattcaggaaggcctacacctttgtattatgctgagaat
cttactaaaaagctgggtggggcaaagatttatctaaagagggaagacctaaaccacaca
ggagcccataaaataaacaacgtattgggacagattttattggcaaaacggatgaataaa
aagagagttatagctgagacaggggcaggacagcatggagtggcaactgctacagctgct
gcaatgtttggaatggaatgcgaaatattcatgggagaagaagatataaaaaggcaatct
ttaaatgtctttagaatgaaacttttaggtgcaaaagtaacaccagtaaaatcagggacg
ggaaccttaaaagatgcagtaaatgaagcaataagggattgggtgacgaatataaacgat
actttttatgtgataggttctgttgttggtcctcatccttatcctacaatggtgagagat
tttcaaagagtgataggggatgaagcaaaagaacaaatacttcaaaaagaaggaagactt
cctgattatgtgattgcttgtgttggtggaggcagcaatgcaatgggaattttctatccc
ttcattgaagataaagaggtaaaattgataggagtagaagcagccggagaagggattgag
acagggaaacatgcagctgcaatggcgaaaggctctgtaggagtattgcacggcatgatg
acttatcttttacaggatgaagaggggagaataatgccagtatactctatatctgcagga
ctggattacccaggtgtaggtccagaacatgcctttttaaaagaaagtaatagagctcaa
tatgtatatgcgacagacgaagaagcattggcggcttttatggatttatctcaaacagaa
gggataataccagctttggaaagtgctcacgctttggcatatgctatgaaactggctcca
aatttaacgaaagacaatattatcattgtaaatttgtcaggcagaggagataaagacgta
aatacagttgcaaaagtattgggggtggagttatga

DBGET integrated database retrieval system