KEGG   Thermoanaerobacter sp. X513: Thet_1072Help
Entry
Thet_1072         CDS       T01317                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
thx00260  Glycine, serine and threonine metabolism
thx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
thx01100  Metabolic pathways
thx01110  Biosynthesis of secondary metabolites
thx01130  Biosynthesis of antibiotics
thx01230  Biosynthesis of amino acids
Module
thx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thet_1072
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thet_1072
Enzymes [BR:thx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thet_1072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADN54680
Position
1073763..1074938
Genome map
AA seq 391 aa AA seqDB search
MSGRFGRFGGQYVPETVMNALIELEREFEKAKQDKDFMEEYRYYLREYSGRPTPLYYAEN
LTKKLGGAKIYLKREDLNHTGAHKINNVLGQILLAKRMNKKRVIAETGAGQHGVATATAA
AMFGMECEIFMGEEDIKRQSLNVFRMKLLGAKVTPVKSGTGTLKDAVNEAIRDWVTNIND
TFYVIGSVVGPHPYPTMVRDFQRVIGDEAKEQILQKEGRLPDYVIACVGGGSNAMGIFYP
FIEDKEVKLIGVEAAGEGIETGKHAAAMAKGSVGVLHGMMTYLLQDEEGRIMPVYSISAG
LDYPGVGPEHAFLKESNRAQYVYATDEEALAAFMDLSQTEGIIPALESAHALAYAMKLAP
NLTKDNIIIVNLSGRGDKDVNTVAKVLGVEL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaagatttggacgttttggaggtcagtatgtgccagagactgtgatgaatgcg
cttatagaattagagagggaatttgaaaaagctaaacaggataaagatttcatggaagaa
tataggtattacttgagggaatattcaggaaggcctacacctttgtattatgctgagaat
cttactaaaaagctgggtggggcaaagatttatctaaagagggaagacctaaaccacaca
ggagcccataaaataaacaacgtattgggacagattttattggcaaaacggatgaataaa
aagagagttatagctgagacaggggcaggacagcatggagtggcaactgctacagctgct
gcaatgtttggaatggaatgcgaaatattcatgggagaagaagatataaaaaggcaatct
ttaaatgtctttagaatgaaacttttaggtgcaaaagtaacaccagtaaaatcagggacg
ggaaccttaaaagatgcagtaaatgaagcaataagggattgggtgacgaatataaacgat
actttttatgtgataggttctgttgttggtcctcatccttatcctacaatggtgagagat
tttcaaagagtgataggggatgaagcaaaagaacaaatacttcaaaaagaaggaagactt
cctgattatgtgattgcttgtgttggtggaggcagcaatgcaatgggaattttctatccc
ttcattgaagataaagaggtaaaattgataggagtagaagcagccggagaagggattgag
acagggaaacatgcagctgcaatggcgaaaggctctgtaggagtattgcacggcatgatg
acttatcttttacaggatgaagaggggagaataatgccagtatactctatatctgcagga
ctggattacccaggtgtaggtccagaacatgcctttttaaaagaaagtaatagagctcaa
tatgtatatgcgacagacgaagaagcattggcggcttttatggatttatctcaaacagaa
gggataataccagctttggaaagtgctcacgctttggcatatgctatgaaactggctcca
aatttaacgaaagacaatattatcattgtaaatttgtcaggcagaggagataaagacgta
aatacagttgcaaaagtattgggggtggagttatga

DBGET integrated database retrieval system