KEGG   Thermoanaerobacter sp. X513: Thet_1073Help
Entry
Thet_1073         CDS       T01317                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
thx00260  Glycine, serine and threonine metabolism
thx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
thx01100  Metabolic pathways
thx01110  Biosynthesis of secondary metabolites
thx01130  Biosynthesis of antibiotics
thx01230  Biosynthesis of amino acids
Module
thx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thet_1073
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thet_1073
Enzymes [BR:thx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thet_1073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ADN54681
Position
1074935..1075723
Genome map
AA seq 262 aa AA seqDB search
MNRIDKKFEVLKGEGRKALITFITAGDPDIETTYDIVLALEEAGSDIIELGIPYSDPLAD
GPTIQASSQRALNKGVKIPDIMKIVEKIRLKSDIPLVYLVYYNSIFKYGIQKFLKESKDV
GIDGLIIPDLPIEERKDILEEADKYGIYLIPLVAPTSKERIKLITENGKGFVYCVSITGV
TGAREDIETDIEEYMKTVSQYTNMPKAIGFGISTPEMAKKLKDFSDGIIVGSALVERIAK
GYNKSEMLQEVKSFVSSLKEVL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaataggattgacaaaaagtttgaagttttaaaaggagaagggcgcaaagccttaata
acctttataacagcgggagacccggatattgagacgacttatgatatagtcttggctttg
gaagaagcaggatctgatataatagaactgggaataccttattctgatcccttagctgat
ggacctacaatacaggcttcttcacaaagagctttaaataaaggtgtaaaaatacctgat
ataatgaaaatagtagaaaaaataaggttaaaaagtgatatccctctggtttaccttgtc
tactataactctatattcaaatatggcatacaaaaatttttaaaagagtcaaaagatgta
gggatagatgggcttatcataccagacttgcctattgaagaaagaaaagatattttagaa
gaagcagataaatacggtatttatttaatacctttagtcgctcccacatcaaaagaaaga
ataaaattaatcactgaaaatggcaaaggatttgtatattgtgtttcaattacaggtgtg
acaggagcaagagaagacattgaaactgacattgaagaatatatgaagacagtctctcaa
tacaccaatatgccaaaggcgatagggtttggcatatctactccggagatggcgaaaaaa
ttaaaagattttagtgatgggattattgtagggagtgcccttgtagaaagaattgctaaa
gggtataataaatctgaaatgctgcaggaagttaagagttttgtatccagcttaaaagaa
gtgttatga

DBGET integrated database retrieval system