KEGG   Thermoanaerobacter sp. X513: Thet_1073Help
Entry
Thet_1073         CDS       T01317                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thet_1073
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thet_1073
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thet_1073
Enzymes [BR:thx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thet_1073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1074935..1075723
Genome map
AA seq 262 aa AA seqDB search
MNRIDKKFEVLKGEGRKALITFITAGDPDIETTYDIVLALEEAGSDIIELGIPYSDPLAD
GPTIQASSQRALNKGVKIPDIMKIVEKIRLKSDIPLVYLVYYNSIFKYGIQKFLKESKDV
GIDGLIIPDLPIEERKDILEEADKYGIYLIPLVAPTSKERIKLITENGKGFVYCVSITGV
TGAREDIETDIEEYMKTVSQYTNMPKAIGFGISTPEMAKKLKDFSDGIIVGSALVERIAK
GYNKSEMLQEVKSFVSSLKEVL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaataggattgacaaaaagtttgaagttttaaaaggagaagggcgcaaagccttaata
acctttataacagcgggagacccggatattgagacgacttatgatatagtcttggctttg
gaagaagcaggatctgatataatagaactgggaataccttattctgatcccttagctgat
ggacctacaatacaggcttcttcacaaagagctttaaataaaggtgtaaaaatacctgat
ataatgaaaatagtagaaaaaataaggttaaaaagtgatatccctctggtttaccttgtc
tactataactctatattcaaatatggcatacaaaaatttttaaaagagtcaaaagatgta
gggatagatgggcttatcataccagacttgcctattgaagaaagaaaagatattttagaa
gaagcagataaatacggtatttatttaatacctttagtcgctcccacatcaaaagaaaga
ataaaattaatcactgaaaatggcaaaggatttgtatattgtgtttcaattacaggtgtg
acaggagcaagagaagacattgaaactgacattgaagaatatatgaagacagtctctcaa
tacaccaatatgccaaaggcgatagggtttggcatatctactccggagatggcgaaaaaa
ttaaaagattttagtgatgggattattgtagggagtgcccttgtagaaagaattgctaaa
gggtataataaatctgaaatgctgcaggaagttaagagttttgtatccagcttaaaagaa
gtgttatga

DBGET integrated database retrieval system