KEGG   Thermoanaerobacter sp. X513: Thet_1110Help
Entry
Thet_1110         CDS       T01317                                 

Definition
Type III site-specific deoxyribonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
thx  Thermoanaerobacter sp. X513
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1112418..1115516
Genome map
AA seq 1032 aa AA seqDB search
MTRKVIFNFDDNLEYQKKAINSVVALFRGQDRELGDVIYRGKTRHIGRISEEIIRNRLDI
GRNVILENLREIQTQNMLFPSADLQPIYNFSVEMETGTGKTYVYLRTILELYKNYNFLKF
IIVVPTVAIRKGVEKNIEILKEHLKTLYDLDISNYAFVYDSNNLNKLMDFVEARDLRIVI
MNIQAFNKDSNKIRREDERGRVLWDLIKYTKPIVIIDEPQRLEGNGKKKSASLKAIEELD
PLFILRYSATHKKLYHQVYKLDSYQAYKQDLVKKIEVKTVYGNISKDYPYVRYIEFTRDL
KAKIEIFYREPGGQVKLRTFNVQKGVSLYELSGELSQYRDMIVLEDPHKINGLKIGYKEG
ILILKEGENNYNLDELDLIRILIRLTIQTHLTKQLKILEKGYKIKVLSLFFIDRVKNFRD
SEAPDGRGIYARIFDEEYEKVIKDPRYNELFKKYPDLFPEYKNVQKVREGYFARDKKNNE
TEIEDWDWGKDELEVKAKSQEDIERGIQLILEKKDELISFDEPLAFIFSHSALREGWDNP
NVFQLCTLKKGSSEIAKKQEIGRGLRLPVDIYGNRCFDSEINVLTVIANDYYDHFAEALQ
KDFRLEEGLDQEEVTFEVIYQTLADAGIPEEFLVADTVEAFRTELINAGIINAKTNQLTK
DAAEIIYYDFTNAILQPYQEAIKEKFIENMKAKGSKRIEIKNGDEEPVENGYNSFVTEKE
FQKLLAELRERINKRTIYHVNIDKEEFIKQSIEEINKHLTYKSIYRQYEVATGGIDFKKS
NELQIHDPAKFTINLGTEAIENNKSDFEIINYLMHQTFLPRKALIRIYSALENKILLQKQ
EILDEVIKILQNKLNEFQAKNIEYEVLDGVVFEEKNIFAVDEIEQWMLNESAKKAYKTKE
EYRKALQKYIRVDSHGEYEFARSLDEDPDVLLFTKLKKGGLVIETPYGNYTPDWAIIHKV
DDHRAKLYFIVESKFDKERVNLTDVEKAKIECARKHFATVSSDVVFDWVNSYERFKDIVN
RSIQKNNVVKGS
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggaaagttatatttaactttgatgataatttagaataccaaaagaaagctatc
aactcagttgtagccctctttagaggacaagatcgggagctgggagatgtaatttatcgt
gggaaaacccgacatataggacgtatatctgaggaaattataaggaatagattggacata
ggaagaaatgttattctagaaaatttacgagaaatacaaacgcaaaatatgctatttccc
tctgctgatttacagcctatatataatttttctgtagaaatggaaacaggtactggtaaa
acttacgtatatttgcggactattttggagctctataaaaattataattttttaaagttt
ataattgtagtgcctacagtggctattcgtaaaggagtagaaaaaaatattgaaattttg
aaagaacatttaaaaaccctttatgaccttgacatttcaaattatgctttcgtttatgat
tcaaataacttaaataagttaatggactttgtggaagctagggatttacgcattgtaatt
atgaatatacaggcatttaataaagacagcaataaaattcgcagagaagatgaaagaggg
cgagttttgtgggacctaataaaatatactaaaccaattgtcattatagatgaaccacag
cgacttgaaggaaatgggaaaaagaaaagtgcttctttaaaggctattgaagaattggat
ccgctattcattttaaggtattcagcaactcataaaaagctttaccatcaagtatataaa
cttgattcgtaccaggcttataaacaggatttagtaaagaaaattgaggttaaaactgtt
tatggcaatatcagtaaagactacccttatgttcgctatatagaatttacccgggactta
aaagcaaaaattgaaattttctatcgtgaaccgggcgggcaggttaaattacgtaccttc
aatgtgcaaaaaggggtaagcctttatgaattatccggagaattatcccaatatagagat
atgattgtattggaagacccgcacaaaattaacggattgaaaattggttataaggaaggt
atcttaatattaaaagaaggagaaaataattataacttagatgaactggacttaatcaga
atattaatccgtttaactatacaaacgcatttaacaaagcaactaaaaattttagaaaaa
ggctataaaatcaaagttttgtcccttttctttatagatcgggttaaaaattttagagat
agtgaagcacctgacggccgaggaatttatgcccgcatttttgatgaggaatatgagaaa
gtaattaaagatccaagatataatgaactttttaaaaaatatcctgatttatttcctgaa
tacaaaaatgtgcaaaaggtaagagaaggttattttgcacgggataagaaaaataatgaa
actgagatagaggattgggactgggggaaagatgaattagaggtaaaagctaaatctcag
gaagatattgaacgtggaatacaacttattttagagaaaaaggatgaactaatttctttt
gatgaaccattggcatttattttttctcattcagctttaagagaaggctgggataaccct
aatgttttccaactgtgtacattaaaaaaaggaagttcagaaattgctaaaaagcaagaa
ataggacgaggcttgcgactgccagtggatatttatggaaaccggtgttttgacagtgaa
ataaatgttttgactgtaattgccaatgactattacgatcacttcgctgaagccttgcaa
aaagattttagattggaggaaggactagatcaggaagaagttacttttgaagttatttat
caaaccttggcagacgctgggattccagaggaatttcttgtggcagatacagtagaagct
tttaggactgaacttattaatgctggaattattaatgctaaaactaaccaactaacgaaa
gatgcagcagagataatatattatgattttacaaatgcaattttacaaccgtatcaggaa
gctattaaagagaaatttatagaaaatatgaaagcaaaaggaagtaagcgaattgagatt
aaaaatggtgatgaagaacctgtggaaaatggatataacagttttgtaacggaaaaagaa
tttcaaaagcttttagcagaattacgtgaacgaataaacaaaagaacaatttaccatgta
aacattgataaagaggagtttattaaacaaagtatagaagaaatcaataaacatcttact
tataaatctatttatcgtcaatatgaagtagcaacaggaggtatagatttcaaaaaatct
aatgagttgcaaatacatgatcctgctaaatttacaattaatcttggaacagaagcaata
gaaaataataaaagtgattttgaaataataaattatctcatgcatcaaactttcttgcca
aggaaagctttaatcagaatttattcagctttagaaaataaaattttattgcagaaacaa
gagattttagatgaagtaattaagattctccagaataaattgaatgaattccaggctaag
aatatagaatatgaggttttggatggagttgtgtttgaagagaagaatatttttgctgtg
gatgaaattgaacaatggatgctaaatgaaagtgctaaaaaagcatataaaacaaaagaa
gaataccgaaaagctctccagaaatatatccgtgtagatagccatggggagtatgaattt
gctagaagccttgatgaagatcctgatgttcttctcttcacaaaattaaaaaagggagga
cttgtaattgaaaccccttatggaaattatacccctgactgggcaataatccataaagtt
gatgatcatagagcaaagttgtattttattgtagagtcaaaatttgataaagaaagagtt
aatttaaccgatgtggaaaaagccaaaattgaatgtgcccgtaaacattttgccaccgta
tccagtgatgtagtttttgattgggtcaatagctatgaaagatttaaagatattgtaaat
agaagtatacaaaaaaataatgtagtgaaaggaagttaa

DBGET integrated database retrieval system