KEGG   Thermoanaerobacter sp. X513: Thet_1119Help
Entry
Thet_1119         CDS       T01317                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Thet_1119
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Thet_1119
Enzymes [BR:thx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Thet_1119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1125037..1125951
Genome map
AA seq 304 aa AA seqDB search
MKRKDLLGIKDLSKEEILEVLDTAKEMKKILNGEKYSQILKGKTVVTIFFEPSTRTRLSF
EMAAKYLGAHYGNIEVATSSVAKGESLIDTIRTVEMMKADVIITRHNMSGAPHLMAKYTN
ASIINAGDGINEHPTQALLDMMTIREKKESFEGLKVAIIGDIMHSRVARSNIWGLKKMGA
EVRVAGPSTLMPPAIEKLGVKAYYNVEEAIEGADVVMGLRIQLERQKSGLFPSIDEYREY
FGINKERMKLAKPDAILMHPGPINRNVELTSEAANDKYSVIEEQVTNGVAVRMALLKILC
ERRN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaagagaaaagacctgttaggcattaaggatttatcgaaagaagaaatactagaagtt
ttagacactgcaaaggagatgaaaaaaattctaaatggagaaaaatattcacagatacta
aagggaaagacagttgtgacgatttttttcgaacctagcacgaggacaagactatctttt
gagatggcagcaaagtatttaggagcccattacggcaatatagaagtggcaaccagcagt
gtggctaaaggggagtctttaatagataccataaggactgttgagatgatgaaggcggat
gtgataataacaagacacaacatgagtggagcgccgcatcttatggcaaaatacacaaat
gcctctatcataaacgcaggagatggtataaatgaacatcccacccaagccttgttggac
atgatgacaatcagagaaaagaaagaaagctttgaaggattaaaagtggcaataatagga
gatattatgcacagcagagttgcacggtcaaatatatggggacttaaaaagatgggggcg
gaagtgagagttgcaggcccttcaaccttgatgccacctgcaatagaaaaattaggagtc
aaggcttactacaatgtagaggaagcaatagaaggagcagatgtggtgatggggcttaga
atacagctggaaagacaaaaaagcggtctttttccctcaattgacgaatatagagagtat
tttgggataaataaggaaagaatgaaacttgcaaaacctgatgcgatattgatgcatcca
gggcctataaacagaaatgttgaacttacgtcagaagcagcaaatgacaagtattctgtt
atagaagaacaggtgacaaacggtgtcgctgtcaggatggcacttttaaaaatactttgt
gaaaggagaaattaa

DBGET integrated database retrieval system