KEGG   Thermoanaerobacter sp. X513: Thet_1231Help
Entry
Thet_1231         CDS       T01317                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:thx00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Thet_1231
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Thet_1231
Enzymes [BR:thx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Thet_1231
Two-component system [BR:thx02022]
 CheA family
  CheA-CheYBV
   Thet_1231
Bacterial motility proteins [BR:thx02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Thet_1231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1229132..1229716
Genome map
AA seq 194 aa AA seqDB search
MKNDCLVIIGASTGGPKALQYILTNLPKDLFASVIVVQHMPEKFTRMMAERLDQSCKIKV
KEAVDGEVILKNVAYIAPGDKNLLLIEENDKIKIKLSTNFESVYKPSIDATFISASQINA
CIIAVILTGMGSDGSKGLKYLKEKGSFIICQDIESSLAKGMPYNAIKTGFVDKILPLDKI
PAEIIEKVRGFYGK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgattgtcttgttataattggggcttctactggggggcctaaagcactgcaa
tatatattgacaaatttaccaaaggacctttttgcttcagtaattgtagtacaacatatg
ccagaaaaatttactagaatgatggcagaaagattagaccaaagttgcaagatcaaagta
aaagaagcagtagatggagaggtaattttgaaaaatgtagcttatattgcacctggcgat
aaaaatttattattaattgaagaaaatgataaaataaaaattaaactttctacgaatttt
gaatctgtttataaaccttccattgatgctacttttataagtgcttcccaaataaatgcc
tgcataatagctgttattttgacaggtatgggaagtgatggttcaaaaggacttaaatat
ttaaaagagaaaggaagttttattatatgtcaggatatcgaatcttctctggcaaaagga
atgccttataacgctataaaaacaggatttgttgataaaatccttcctttggataaaatt
ccagcagaaataattgagaaggtgaggggattttatggaaaataa

DBGET integrated database retrieval system