KEGG   Thermoanaerobacter sp. X513: Thet_1384Help
Entry
Thet_1384         CDS       T01317                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thet_1384
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Thet_1384
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Thet_1384
Enzymes [BR:thx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Thet_1384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1366410..1367528)
Genome map
AA seq 372 aa AA seqDB search
MRIVVKVGTSTLTYENGKLNLEIMEKLVRQIANLLNRGEEVVLVTSGAIGAGMGKLNLKE
KPKTIPEKQSLAAIGQGLLIEIYEKFFNEYGKITAQVLLTKEDFSDRRRYLNVSYTLSNL
LKWGVVPIINENDTVTVDEIKIGDNDTLAALLASLVEADILIILTDIDGLYDKDPRIYKE
AKIIEVVEEFSDELFKIAGSAGTKRGTGGMYTKIQAAKICWNSGVKMIIANGKIDNVLNQ
IANGEKIGTTFLPMKKPISSRKVWIAFNAKVSGRLFIDEGAAKAIIKHGKSLLPSGVVKT
EGDYDVGDCVAVVDHQEKEIARGLINYSSEEVEKIKGCKTHEIEKILGYKYYDEVIHRDN
LVILERGEKFGS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgtagtaaaagttggtacaagcactttgacatatgaaaatggtaaattgaat
ttagaaataatggagaagttagtaaggcaaattgctaatttattaaacagaggagaggaa
gtagtattagtaacttctggggcaattggggcgggaatgggaaaattaaatttaaaggaa
aaacctaaaaccatcccagaaaagcaatccttagcggctatagggcaagggcttttaatt
gaaatttatgaaaagttttttaatgaatatggcaaaattactgcgcaagttcttttgact
aaggaagattttagcgatagaagaagatatttaaatgtcagttataccttgtcaaacctg
ctcaaatggggtgttgtgccaataataaatgaaaatgatacagtaactgttgatgaaatt
aaaattggagacaatgacactttagcggcgctgcttgctagtttagttgaggctgatatt
ttaataattttaactgacattgatgggctttatgataaagaccctcgaatttataaagag
gcaaaaattatagaagtcgtagaagagttttcagatgaattgtttaaaattgctggtagt
gctgggacaaaaagaggaactgggggaatgtatacaaagattcaggcagcaaagatatgt
tggaattcaggagttaagatgattatagcgaatgggaaaattgacaatgtattaaatcaa
atagcaaatggcgaaaaaattggcactacatttttgcctatgaaaaagccaataagtagc
agaaaagtttggattgcttttaatgcgaaagtgagcggaagactttttattgatgaagga
gcagcgaaagctattataaagcatgggaaaagtctattaccaagtggagttgtaaaaact
gaaggggattatgatgtaggagactgtgttgcagtggttgaccatcaagaaaaagagatt
gccagaggacttattaattattcttcagaagaagttgaaaagataaaaggttgtaaaact
catgagatagaaaagatattaggttataaatattacgatgaagtaatccatagggataat
cttgtaatacttgaaagaggtgagaagtttggaagttga

DBGET integrated database retrieval system