KEGG   Thermoanaerobacter sp. X513: Thet_1598Help
Entry
Thet_1598         CDS       T01317                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thet_1598
   01230 Biosynthesis of amino acids
    Thet_1598
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thet_1598
   00051 Fructose and mannose metabolism
    Thet_1598
   00562 Inositol phosphate metabolism
    Thet_1598
Enzymes [BR:thx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Thet_1598
Exosome [BR:thx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Thet_1598
  Exosomal proteins of bladder cancer cells
   Thet_1598
  Exosomal proteins of melanoma cells
   Thet_1598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1568557..1569327)
Genome map
AA seq 256 aa AA seqDB search
MTSKGVFVLRRPIIAGNWKMHMTPSEAVKLVDELIPQVKDAKAEVVVIPPFVDLTEVNKV
IQGTNILLGAQDMFWEEKGAYTGEISPLMLKEIGVKYVVIGHSERRQYFGETDEMVNKKV
LSALSHGLSPIVCVGESFSQREEGKTFEVVLSQTKEALKGVTHDDIVNVVIAYEPIWAIG
TGKTATAKDANEVIKAIRNTIASLYGKEKADLVRIQYGGSVKPENISELMAESDIDGALV
GGASLVASDFAKIVNY
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtaaaggggtgtttgttttgagaagaccaataattgcaggtaattggaaaatg
cacatgaccccttctgaagcggtgaaattagttgatgaattgatacctcaagtgaaagac
gcaaaagcagaagtggtagtcatacctccctttgtggatttgacagaggtaaataaagta
attcaaggtactaatattcttctcggagcacaagatatgttttgggaagaaaagggcgca
tatacgggggaaatttcacctttaatgcttaaagagattggggtaaaatatgttgtaata
ggccactctgaaagaaggcagtattttggtgagacggatgaaatggtcaataaaaaagtt
ttatccgctctatctcacggcttaagtcctattgtgtgtgtaggagaatctttttctcaa
agagaagaaggaaaaacttttgaagtagttttaagtcaaactaaagaggctttaaaaggc
gttacccacgatgatattgtaaatgtagtaatagcttatgagccaatttgggctataggt
actggcaaaacggctacagctaaagacgccaatgaagtgataaaagctataagaaatact
atagcttccctttatggaaaagaaaaagcagatctggttagaatacaatatggggggagt
gtaaagcccgagaacatctctgaactcatggcagagagcgatatagacggggctttagtg
gggggagcaagtcttgtagcatcagattttgcaaagattgtcaattattaa

DBGET integrated database retrieval system