KEGG   Thermoanaerobacter sp. X513: Thet_1818Help
Entry
Thet_1818         CDS       T01317                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Thet_1818
  Lipid metabolism
   00600 Sphingolipid metabolism
    Thet_1818
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Thet_1818
Enzymes [BR:thx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Thet_1818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1778930..1781161)
Genome map
AA seq 743 aa AA seqDB search
MGREILNFNVDWLYIPEDLNDAYKLDFDESNFEFVSLPHANKIFPHHYFKEEDYRFVSWY
RKHFKLDSKYEGKKVYIHFEGVMTVAMVYVNGEFVGEHKGGYTPFEFDITEYVKYGDFEN
LIAVQVDSREHKDIPPEGHLVDYMLFGGIYRNVWLKILNETYIQDVYFVVDKLQDSVAEI
SITTTIEGKEVRNAKILTEVINKEGAVCSSSVTDVKDMQKEIVQRIKMENPLTWYPDHPY
LYNVSVKLIAENEILDNYTFRTGIRTVHFGDDGKFYINGEPLKLRGLNRHQTFPYVGGAM
PDRVQRKDADILKYDLGLNYVRTSHYPQAVSFLDRCDEIGLLVFEEIPGWQHIGDENWKN
IAKENLKEMILRDRNHPCIFMWGVRINESLDDHDFYKEMNEIAHKLDRSRPTGGVRYLRD
SEKLEDVFTYNDFIYNLEGKIQLPNHKKYMVTEYMGHMYPTKSYDNLNRLITHARLHALI
QDKQYGIPNMAGASGWCAFDYNTTSAFGSGDNICYHGVCDIFRLPKFAAHFYRSQADPHL
YGPYVFIASYLIPSFEEENGDKLLVFSNCEEVELYINDKFVKRQMPNRVDFPSLPHPPFE
FSMKECGINYMEVRVNNASITAIGLIDGKEVARHTLRPYGKPHKLILSCDDNEIMADGAD
CTRVVISVVDENGSILPYANIPVSFEIEGEGKLIGENPLTLEAGRGAVYVKSTRKPGEII
LKAKSHYVAEESNVSIKTKSIGY
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgggtagagagattttaaattttaatgtagattggctatatattcctgaagacttaaat
gatgcatataaacttgattttgatgaaagcaattttgaatttgttagtcttcctcatgca
aacaagatatttcctcatcactattttaaagaggaagattataggtttgtttcgtggtat
agaaagcactttaaactagatagcaaatatgagggtaaaaaggtttatattcattttgaa
ggtgttatgactgttgcgatggtttatgtaaatggcgaattcgtaggagaacataaagga
ggatataccccttttgaatttgacattacagaatatgtcaaatatggcgattttgaaaat
ttaattgctgtacaagtggattcaagagaacataaagatattcccccagaaggtcatctt
gtagattatatgttgtttggtggaatatacagaaatgtatggttgaaaattttaaatgaa
acttatatacaagatgtttattttgttgttgataaattgcaagattctgttgctgaaatt
tcaattactacaaccatcgaaggtaaagaggtaagaaatgcaaaaatattgacagaggtt
ataaataaagaaggtgctgtgtgttcatcttcggttactgatgttaaagacatgcaaaag
gagattgtacagcgaataaagatggagaatccattaacttggtatccagatcatccgtat
ttatataatgtgtctgtaaaacttattgcagagaatgaaattttagataattatactttt
agaacaggaataagaactgtgcattttggagatgacggtaagttttatattaatggtgaa
cctttaaaattaagaggattaaacagacatcagacttttccttatgttggcggtgctatg
ccggatagggttcaaagaaaagatgcagatatactaaagtatgacttgggattaaattat
gttaggacgtcacattatccgcaggctgtttcatttttggatagatgtgatgaaataggc
ttgttagtttttgaagagatacctggatggcagcatataggcgatgaaaattggaagaac
attgcaaaagagaatttaaaagaaatgattttaagagatagaaatcatccttgtatattt
atgtggggtgtgcgaataaatgagtctttagatgaccacgatttttataaagaaatgaat
gaaatagctcataaattagacagaagtagaccaacaggtggtgttagatatttaagagat
agtgaaaagctagaggatgtatttacatataacgactttatatacaatttagaaggcaaa
atacaacttccaaatcacaaaaagtatatggtaacagaatatatgggtcacatgtatccg
acaaaatcttatgataaccttaatcgacttattactcatgcaaggttgcatgctcttatt
caagacaaacaatatgggataccaaacatggctggtgcatcaggctggtgtgcatttgat
tataataccacaagtgcttttggttcaggagacaatatatgctatcatggagtctgtgat
atatttagacttccaaagtttgcagctcatttttacaggagtcaagccgacccgcactta
tatggaccctatgtgtttatagcttcgtacttaataccatcatttgaggaagagaacggc
gataaattgcttgtatttagcaattgcgaagaagtagaactttatataaatgataaattt
gtgaaaagacaaatgcccaatagagttgattttcctagtttaccacatccgccttttgaa
ttttcaatgaaggaatgcggaatcaactatatggaggtaagagttaataacgcttctatt
actgcgataggtttgatagacggtaaggaagtagcaagacatacattaaggccatatggg
aaaccacataaattaattctttcttgtgatgataatgagattatggcagatggcgctgat
tgtacacgggttgttataagtgttgtagatgaaaacggctctattcttccatatgctaat
atacctgtatcatttgaaatagaaggtgaaggaaaactgattggagaaaatccgttgaca
ttagaggctggcagaggagcagtttatgtaaaatcgacacgaaagccgggagaaataatt
ttaaaagctaaatctcattatgtagcggaagaaagcaatgtatctataaaaactaagtca
ataggatattaa

DBGET integrated database retrieval system