KEGG   Thermoanaerobacter sp. X513: Thet_1896Help
Entry
Thet_1896         CDS       T01317                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Thet_1896
Enzymes [BR:thx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Thet_1896
Exosome [BR:thx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thet_1896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1863093..1864586)
Genome map
AA seq 497 aa AA seqDB search
MAKYIMAFDQGTTSSRAIIFDHSGKIVASQNQEFKQIYPKAGWVEHDPMEIWGTQIGVAK
GVIEKAGINPEDIAAIGITNQRETTVVWDKNTGKPIYNAIVWQCRRTAPICDELKNKGFD
KKIREKTGLVVDAYFSGTKIKWILDNVEGAREKAEKGELLFGNIDTWLIWNLTRGKVHVT
DYSNASRTMLFNIHELKWDKEILEELNVPEQMLPEVKPSSYVYGYTDKSIFGVEIPIAGD
AGDQQAALFGQACFKPGMAKNTYGTGCFMLMNTGEKAVPSNTGLLTTIAWGIDGKVEYAL
EGSIFIAGAAIQWLRDELRIIDNSPQSEEYALKVEDTNGVYVVPAFVGLGAPYWDMYARG
TIVGLTRGAKREHIIRATLESIAYQTRDVLEAMQEDSGIKLQALKIDGGASANNFLMQFQ
SDILGVPVDRPQVIETTALGASYLAGLAVGFWNSKEEIEKNWNVDKHFEPAMDNEKREKL
YKGWKKAVERAMKWAEE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtacattatggcttttgaccaggggacaacaagttcccgtgcgataattttt
gaccatagtgggaaaattgtggcttcacaaaatcaagaatttaagcaaatttatcctaag
gcaggttgggtagaacatgatccaatggagatatggggtacacaaataggtgttgcaaaa
ggtgttatagaaaaagcgggtattaatccggaggatattgcagctattggcattacaaat
cagagagagacaactgttgtatgggataaaaatacaggaaaacctatttacaatgcaata
gtgtggcaatgcagaagaactgctcctatatgcgatgaactaaaaaataaaggttttgac
aagaaaattagagaaaaaaccggacttgtagtagatgcatatttttctggtactaaaata
aaatggattttggataatgttgaaggagcaagagaaaaagcagaaaaaggagaattgctt
tttggaaatattgatacctggcttatttggaatttgacaaggggtaaggtacacgtaact
gactattctaatgcgtcaaggacgatgctttttaatatccatgaattaaaatgggataaa
gagatattagaagaacttaatgtcccagagcaaatgcttcctgaagttaagccttccagt
tatgtatatggctatactgataaaagtatatttggagtagagatacctattgccggagat
gcgggagaccagcaggcagctttgtttggtcaagcctgtttcaaacctgggatggcaaaa
aacacctatggaacaggctgctttatgctcatgaatactggtgaaaaggctgtaccttcc
aatactggacttctcactacaatcgcttggggaattgatggcaaagtagaatatgcctta
gagggtagtatatttatagcaggtgctgcgatacagtggctgagagacgagcttagaata
attgacaattcacctcaaagtgaggaatatgcgctgaaagttgaagacacaaatggtgta
tatgttgttcctgcttttgtaggattaggagccccttattgggatatgtatgcgagaggc
actattgtaggacttacaagaggcgcaaagagagagcatataataagggcaacactggag
tctattgcttatcagacaagagatgtattagaggctatgcaagaggattcaggtattaaa
ttgcaggctttaaaaattgacggtggagcaagtgctaataacttcttgatgcaattccaa
tctgacattttaggtgttccagttgacaggcctcaagtaattgaaactactgctcttggc
gcttcttatcttgcgggattggcagtaggattctggaacagcaaagaagaaatagagaag
aattggaatgttgataaacattttgaaccagctatggataatgaaaagagagaaaaattg
tataaaggttggaaaaaggctgtagaaagggctatgaaatgggctgaagaataa

DBGET integrated database retrieval system