KEGG   Thermoanaerobacter sp. X513: Thet_1945Help
Entry
Thet_1945         CDS       T01317                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thet_1945
   01230 Biosynthesis of amino acids
    Thet_1945
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thet_1945
   00030 Pentose phosphate pathway
    Thet_1945
   00051 Fructose and mannose metabolism
    Thet_1945
   00052 Galactose metabolism
    Thet_1945
  Energy metabolism
   00680 Methane metabolism
    Thet_1945
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Thet_1945
Enzymes [BR:thx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Thet_1945
Protein phosphatases and associated proteins [BR:thx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Thet_1945
Messenger RNA biogenesis [BR:thx03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Thet_1945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1922368..1923612)
Genome map
AA seq 414 aa AA seqDB search
MYTKSNCLIAQSGGPTAVINSSLYGAIMEASRSEKIGKVYGGINGIEGIIKGNIIDIFDI
PYERIKQMRFSPAAALGSCRYRLKDYLEDEEEYKKLIEIFKKYNIKYFFYIGGNDSMDAV
DKISKYAREIGFEINVIGIPKTIDNDLMFTDHSPGFGSAAKYIATTTLELALDAEVYETK
TINVLEVMGRNAGWLTASSALVKERLPHLKQLIYLPEIPFNEERFLEDVNKAYKEYGNVF
ITVSEGLMDEKGNYIGRKENAYHKDAFGHPQLGGVGDYIEKLVKEKIYKRVKMTRLGVTQ
RCAMHLASKVDFEEAEMLGREAVKYALCGETGKMISLVRERNYPYTVKTDIVDVDKVCNK
EKKMPLNWINEEGNYVTEEFFDYARPLIQGEVKVPMAEGLPYYINLKYAIKKQE
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtatactaaaagcaattgtcttatagcacaatcaggtggtcctacagctgttattaat
tccagtctgtatggagctataatggaagcttcgcgctcggagaaaattggcaaagtttat
ggtgggataaacggcatagaaggtataataaaaggcaatattattgacatatttgatatt
ccctatgaaagaataaaacaaatgagatttagccctgcggctgcattagggtcgtgccga
tataggttaaaagactatttagaggatgaagaggaatacaaaaagttaatagaaattttt
aagaaatacaacattaaatattttttctacataggtggcaatgattctatggatgccgtt
gacaaaatcagtaaatatgcaagagaaataggttttgaaataaatgtaattggaattcct
aagactattgataacgatttgatgtttacagatcattctcctggttttggaagtgcggca
aaatatatagccacaactactttagaacttgctttagatgcggaagtgtatgagactaaa
acaattaacgtactcgaagtgatgggcagaaatgcaggttggcttaccgcttcttctgct
ttggttaaagaaagattgccccatttgaaacaacttatttatcttcctgagatacctttt
aatgaggaaagatttttagaggatgtaaataaagcttataaggaatatggcaatgtcttt
ataactgtgtcagaaggacttatggatgaaaaagggaattacattggaagaaaagaaaat
gcttatcataaagatgcttttggtcatcctcaactgggaggagtaggagactatatagaa
aagcttgtaaaagagaaaatatataaacgtgtcaaaatgaccagacttggtgtaacgcaa
agatgtgcaatgcacttggcatctaaagtggattttgaagaagctgaaatgttggggagg
gaagcagtaaagtatgcgttatgtggtgaaaccgggaaaatgataagccttgtaagagaa
agaaattacccatacactgttaaaacagatattgtagatgttgataaagtgtgtaacaag
gagaaaaaaatgcctttaaattggataaatgaagaaggtaattatgttactgaagaattt
tttgattatgcaagaccacttatacaaggagaagtgaaggtccctatggcagaagggtta
ccttattatataaacttaaaatatgcgataaaaaagcaggaataa

DBGET integrated database retrieval system