KEGG   Thermoanaerobacter sp. X513: Thet_2072Help
Entry
Thet_2072         CDS       T01317                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:thx00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2031774..2033231)
Genome map
AA seq 485 aa AA seqDB search
MNNLRVRFAPSPTGAIHIGNIRTALFNYLFSRSEGATFVLRIEDTDLERSSKEFEELIFK
ELEWLGIEWDEGPDKPGPYGPYRQSERLEIYHKFAQKLIEEKKAYRCYCTPEELEEDRRK
AVERGDIPRYSGRCRYLTKEQEEAFIREGRKPVIRFIIPDDEVIEFEDMIKGKITIKSDT
LGGDMVIVKSDGMPTYNFAVVIDDALMKITHVIRGEDHIYNTPKQILIYKALGFEIPKFA
HAPLILGPDRTKLSKRHGNTYIGQYRELGYLPEAMFNFLSLLSWSPEDNVEIMSKEEIIK
KFNFRRIHSANPVFDIEKLNWMNQQYIQKSSIERIVDLAIPHLRRAGYIDGIDDMVYNWL
KDVISLYKDGLQYVAQITEKAKMFFVEEVEYSDETVKILNSPNSKIVLEVVKKVIEEADE
ITEEYVKDLLKKLQKETKVKGKEFFMPIRVAITGEDHGPELVKIIPLLGKDKVINRLKKA
INLIK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatttgagagttagatttgcgccaagcccaactggagctattcatatagggaat
ataagaactgctttatttaattatcttttttcaagaagtgaaggggctacttttgtttta
aggattgaagacacggacttagaaaggtcttcaaaagagtttgaagaattaatttttaaa
gaattagagtggttaggtatagaatgggacgaaggaccagataaaccaggtccctatggc
ccttataggcaaagtgaaagacttgaaatttatcataaatttgcccagaaacttattgaa
gaaaaaaaggcatatagatgttattgtactccggaggaattagaagaagatagaagaaag
gcagtagaaagaggagatatacctcgttattctggaaggtgtaggtatcttacaaaggag
caagaagaggcttttataagagagggaagaaaacctgtaataaggtttattattcctgac
gatgaagttatagagtttgaagacatgataaaaggaaaaattacaataaaaagtgatact
ttaggcggggacatggtaattgtcaaatcagacggaatgcctacttacaattttgcagtt
gtaatagatgacgctcttatgaagattacccatgtcataagaggagaagaccatatatac
aatactccgaaacagatactcatttacaaggctttaggatttgaaattcctaagtttgcc
catgcgcctttaatattgggaccagataggactaaactttctaaaaggcatgggaatact
tatataggccagtatagagaattgggatatttgccagaagctatgtttaactttttatct
cttttaagttggtcaccggaggataatgtagaaatcatgtcaaaagaagaaataataaag
aaatttaatttcagaaggattcacagtgctaatcctgtctttgatattgaaaagcttaat
tggatgaatcaacagtatatacaaaaaagttctattgagagaattgtagatttggctatt
ccacatttaagaagggcaggatacattgacggaatagatgatatggtgtataattggcta
aaggatgtaatatccctttacaaagatggactccaatatgtggctcaaattactgagaaa
gctaagatgttttttgtagaagaagttgagtattctgatgaaacggtgaaaatattgaat
agcccaaatagtaaaattgtactagaagtagttaaaaaagtcatagaggaagctgatgaa
ataacagaggaatatgttaaagatttgcttaaaaaattgcaaaaagaaaccaaggtaaaa
gggaaagaatttttcatgccaatcagagtagcaataacaggagaagaccatggacctgaa
ttggtgaagattattcctcttttggggaaggataaagtgataaataggctgaaaaaagcg
ataaatttaataaagtaa

DBGET integrated database retrieval system