KEGG   Thermoanaerobacter sp. X513: Thet_2258Help
Entry
Thet_2258         CDS       T01317                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thet_2258
   01230 Biosynthesis of amino acids
    Thet_2258
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thet_2258
  Energy metabolism
   00680 Methane metabolism
    Thet_2258
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thet_2258
Enzymes [BR:thx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Thet_2258
Exosome [BR:thx04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Thet_2258
  Exosomal proteins of melanoma cells
   Thet_2258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2212619..2213374)
Genome map
AA seq 251 aa AA seqDB search
MHKVVLLRHGESLWNMENRFTGWTDVDLSPKGIEEARESGKTLKAEGYTFDCAFTSVLKR
AIRTLWIVLDELDRMWIPVYKSWRLNERHYGALQGLNKAETAKKYGEEQVKIWRRSADVR
PPALEKDDPRYPGFDPRYADLSEEEIPLTENLIDTINRVIPYWESTIAPTIKSGKKVLIV
AHGNSLRGLVKYLDNLSKQEIMELNIPTGIPLVYELDDDLKPIRHYYLADEEKVKEKKEL
VENQGKIQGNS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagttgttttgctaagacatggagaaagcctgtggaatatggaaaacagattt
actggctggacggatgttgatttatctccaaagggcattgaagaagctcgggaaagcggc
aagactttaaaggcagaagggtacacttttgactgtgcttttacttctgttttaaaaaga
gctataagaactttgtggattgttcttgacgaattagacaggatgtggataccggtttat
aaatcatggaggctcaatgaaaggcattatggagcactgcaagggcttaataaagctgag
accgccaagaaatacggagaagagcaggtaaaaatatggagaagatctgctgatgtaagg
cctcccgccttagaaaaagatgacccgagatatcccggttttgaccccagatatgctgac
ctttctgaggaagaaatcccccttactgaaaatttgattgatacaattaacagagttatt
ccatattgggagtccacaattgcaccgactataaaatcaggtaaaaaagtgctaatagtt
gctcatggaaatagtttgagagggcttgtaaaataccttgacaatctttctaagcaggag
ataatggagttaaatattcctacaggaattccgttagtttatgagcttgacgatgattta
aaacctataaggcattattatcttgccgatgaagagaaagtaaaagagaagaaagaatta
gtagaaaaccaaggaaagattcaagggaattcttaa

DBGET integrated database retrieval system