KEGG   Thermoanaerobacter sp. X513: Thet_2299Help
Entry
Thet_2299         CDS       T01317                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Thet_2299
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thet_2299
   00620 Pyruvate metabolism
    Thet_2299
   00650 Butanoate metabolism
    Thet_2299
  Lipid metabolism
   00071 Fatty acid degradation
    Thet_2299
  Amino acid metabolism
   00350 Tyrosine metabolism
    Thet_2299
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Thet_2299
   00626 Naphthalene degradation
    Thet_2299
Enzymes [BR:thx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Thet_2299
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Thet_2299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2259638..2262256
Genome map
AA seq 872 aa AA seqDB search
MPTLLQEKKETKEKTEVKETTDVKKQIDLLVERAKRAQEKFMSYTQEQINEIVKAMALAG
IEKHVELAKLAHEETKMGVYEDKITKNLFAVEYVYNYIKDKKTVGILKENLEENYMEVAE
PVGVIAGVTPVTNPTSTTMFKCLIAIKTRNPIIFSFHPKALKCSIEAAKTMYEAALKAGA
PEGCIGWIETPSIEATQLLMTHPDISLILATGGAGMVKAAYSSGKPALGVGPGNVPCYIE
KTANIKRAVSDLILSKTFDNGTVCASEQAVIIDEEIADEVKKLMREYGCYFLNKEETKKL
EEFAIDKNTGLMNPAVVGQPATKIAEMAGFKVPENTKILVAEYPAVGPEYPLSREKLSPI
LALYTVKDYNEGIKRCEEMTEFGGLGHSAVIHSENQQIINEFAKRVRAGRILVNAPASQG
AIGDIYNTAIPSLTLGCGTMGRNSTTDNVSVYNLINIKRVFIRKERMKWFRVPPQIYFER
GSLQYLSQVKGKKAFIVTDPVMVKLGFVDKVTYQLDKANIKYEIFSEVEPDPSVDTVEKG
VKIMRGFEPDLLIAVGGGSAIDAAKGMWLFYEYPDTKFEDLRLKFMDIRKRTYRFPELGK
KALFIAIPTTSGTGSEVTAFAVITDKKKNIKYPLTDYELTPDIAIIDPDLTMTIPPSVTA
DTGMDALTHAIEAYVSVMASDYTDALAEKAIKLIFEYLPKAYKNGQDKVAREKMHNASCI
AGMAFTNAFLGINHSMAHILGAKFHLPHGRANAILLPYVIEYNAELPKKFASFPQYEYPK
AAEKYAEIAKFLGLPASTIEEGVKSLIEAIKNLMKELNLPLTLKEAGINKEEFEKQIMEM
SDIAFNDQCTGSNPRMPLVSEIAEIYRKAYGE
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccttattacaagaaaaaaaggaaacaaaagaaaaaacagaagtaaaagaaaca
acagatgttaaaaagcagatagacctattagtagaaagagcgaaaagagcacaagaaaaa
ttcatgtcatacacccaagagcaaattaatgaaatagtcaaagccatggcactagcaggc
atagaaaagcatgtagaactggcaaaattagctcatgaagagacgaaaatgggggtttat
gaagacaaaataaccaaaaacctttttgcagtagaatatgtgtacaattatataaaagac
aaaaaaactgtcggcatcctcaaagaaaacttagaagaaaattatatggaagtggcagaa
cctgtaggagttatagccggcgtaacacctgtcacaaacccgacttctacaacaatgttc
aaatgcctcattgctatcaaaacaagaaatccaataattttcagcttccacccaaaagca
ttaaaatgtagtatagaagcagcaaagacgatgtacgaggcagcattaaaggctggtgca
ccagaaggatgtataggatggattgagacaccctcaattgaagcaacacaacttctcatg
acacatcccgatatatctcttatcctagcaacaggcggcgccggaatggtaaaagctgct
tacagctcaggaaaacccgcccttggcgtaggtcctggcaatgtcccctgctatattgaa
aaaactgcaaatattaaaagagcagtttcagatttaatacttagtaaaacttttgacaat
ggtacagtatgtgcctcagagcaagctgtaataatagatgaagaaatagccgatgaagta
aaaaaattaatgagagaatatggttgctatttcttaaataaagaagaaactaaaaagtta
gaagaattcgctatagacaaaaacaccggtttaatgaatccagcagttgtaggtcaaccg
gcaacaaaaattgctgaaatggctggatttaaagtacctgaaaacacaaaaatacttgta
gctgaatatcctgctgtaggaccagaatatcctctctccagagaaaagctaagtccaata
cttgctttatacacagtcaaagattacaacgaaggcataaaaagatgtgaagaaatgaca
gaattcggcggacttggtcactctgcagtaatacattctgaaaaccaacaaattattaat
gaatttgcaaaaagagtacgagcaggaagaattcttgtaaacgcccctgcttctcaagga
gctattggagatatttataacacggctatcccatctttgactttgggttgcggtacaatg
ggtagaaattcaacaacagataatgtaagtgtttataaccttataaacataaaacgagtt
tttataagaaaagagagaatgaaatggttcagagttccaccacaaatttattttgaaaga
gggtcattacaatatctgtcacaagtaaaaggcaaaaaagcctttattgtaacagaccct
gtgatggttaaattaggttttgtagataaagtaacgtatcaattagataaggcaaatatt
aaatatgaaatattctctgaagttgaaccagatccttcagttgacactgtagaaaaaggg
gtaaaaataatgagagggtttgagcctgacttactaatagctgtaggtggtggttctgca
atagatgcagcgaagggaatgtggcttttctacgaataccctgatacaaaattcgaagac
ttaaggttaaaatttatggacataagaaaaagaacttatagatttcctgaactggggaaa
aaagctttatttatcgcaataccaaccaccagcggtacaggttctgaagttactgccttt
gcagttataacagacaaaaagaaaaatataaagtaccctctcacagattacgaattaaca
ccagatatcgctataatagaccctgacctcacaatgacaataccaccctctgtcacagca
gacactggtatggacgctttaacccatgctattgaagcctatgtatctgtaatggcatca
gactatacagacgctctcgcagaaaaagctataaaattgatatttgaatatctacctaaa
gcatacaaaaacgggcaagataaagtcgcccgcgaaaagatgcacaatgcttcatgcata
gctggaatggccttcacaaatgcatttttaggaataaaccatagtatggctcatatactt
ggtgctaaattccatcttccacacggaagagcaaatgcaatacttctgccctatgtcata
gaatacaatgctgagttacctaaaaaatttgcttcattcccacaatatgaatatcccaaa
gcagccgagaaatatgcagaaattgcaaaattcttgggacttcctgcatcaaccattgaa
gaaggagtaaaaagcctcattgaagcaataaaaaatcttatgaaagagcttaatcttcct
ttgacacttaaagaagcaggcataaataaagaagaattcgaaaaacaaataatggaaatg
tctgatatagcctttaatgaccagtgcaccggttcaaacccaagaatgccattggtatcc
gaaattgcagaaatatatagaaaagcctatggagaataa

DBGET integrated database retrieval system