KEGG   Thermodesulfatator indicus: Thein_0027Help
Entry
Thein_0027        CDS       T01546                                 

Definition
(GenBank) hypothetical protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(30069..30182)
Genome map
AA seq 37 aa AA seqDB search
MNNTTGILILKSIPQEKKDKVAEFLAKFVGKTAIKRI
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
atgaataatactacgggaatcttgattcttaaatctattccccaagaaaaaaaggataaa
gtggctgaatttttggccaaatttgtcggaaaaacggcgataaagagaatttag

DBGET integrated database retrieval system