KEGG   Thermodesulfatator indicus: Thein_0033Help
Entry
Thein_0033        CDS       T01546                                 

Definition
(GenBank) protein of unknown function DUF34
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(35220..36338)
Genome map
AA seq 372 aa AA seqDB search
MAITVEEIIAALESWAPKKLAEDWDNVGLQLGSLKKQVKHLGVCLDLTPETLAQALTQKI
DCLVTHHPFFFKSTKQICWDTWPGKAVKTLAEKDISLIACHTNLDSAKEGVSDVLGEALH
LKVERALLPAKATKLFLITTYVPKGYEEKVREILLKEGAGQRGKYSGCSFATEGIGSFYP
KEEAKPYRGKVGKLNLVSGTKMEFLVPEFLLARVIAKIKEVHPYEEVPIDVWPTEAYDYR
YGLGRIGELPLEYTLYELAQKLSQLLNSQAIFMVGDPKQLVKRVALCGGAGGDFFENALS
LGAEVYITAEVKYHQAREAEARGLSLISVGHFESESLIVPKMAEFFQKMANSKGEELQIT
MLKEKNPFIPLF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcgataacagtcgaggaaattatagccgctttagaaagttgggcccctaaaaaacta
gctgaggattgggataacgttggtctccagcttggatccctcaaaaaacaggtaaaacat
cttggtgtttgcttagaccttacccctgagaccctggctcaagccttaactcaaaaaatc
gattgccttgtcacccatcatcccttcttttttaagtccaccaagcaaatttgttgggac
acctggcctggtaaggcggtaaaaactcttgctgaaaaagatatttcccttatagcctgt
cataccaaccttgattcagcaaaagagggagtgagtgacgttctaggcgaagccttgcat
ttaaaagtagaaagagctcttttgccggctaaagccacgaagttatttttgataactact
tacgtacctaaaggttacgaagaaaaagtaagagagattttgttaaaagaaggggctggc
cagaggggaaaatatagtgggtgttcttttgccacagagggtataggaagtttttatcct
aaagaagaggcaaaaccttacagaggaaaagttggcaagctcaacttagtgtctggaacc
aagatggaatttttagtacctgaatttttgctggctcgagttatagccaaaatcaaggaa
gtacacccttacgaagaggttcccatagatgtatggccgactgaggcttatgattaccgt
tatggcctgggccggataggtgaactcccattggaatatactctttatgagctggctcaa
aaattgagccaactacttaattcacaggctatttttatggtgggagaccctaagcaactg
gtcaaaagagtggccctttgtggtggagcaggaggggacttctttgaaaatgcgctttct
ctgggggccgaggtctatattaccgctgaggtcaagtatcaccaggctcgtgaggctgaa
gctagagggctttccttgatttctgttggccattttgagtccgaaagcctcatagtgcct
aaaatggcggaattttttcaaaaaatggccaacagcaaaggtgaagaactacaaattacc
atgttaaaagaaaaaaacccgtttataccgttattttaa

DBGET integrated database retrieval system