KEGG   Thermodesulfatator indicus: Thein_0035Help
Entry
Thein_0035        CDS       T01546                                 

Definition
(GenBank) DNA primase
  KO
K02316  DNA primase [EC:2.7.7.-]
Organism
tid  Thermodesulfatator indicus
Pathway
tid03030  DNA replication
Brite
KEGG Orthology (KO) [BR:tid00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Thein_0035
Enzymes [BR:tid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.-  
     Thein_0035
DNA replication proteins [BR:tid03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Thein_0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_N zf-CHC2 Toprim_2 Toprim_4 DnaB_bind Toprim Toprim_3 CUT
Motif
Other DBs
NCBI-ProteinID: AEH43920
UniProt: F8A8B6
Position
complement(38234..39931)
Genome map
AA seq 565 aa AA seqDB search
MSLKEAVRRIKEVANIVDVIGEHVALKKVGRNYLGLCPFHADRKPSFTVNEERQIFHCFG
CGAGGDVIAFYMKFHNLDFVAAVKELASRFNISISWDTKEDSLREKLFEINQKAKRFFEH
LLWSSKEGEKARGYLKERGISSKVAKAFGLGFAPASYDSLASHLKLVGASLELAEQAGLL
VRRTDGSFYDRFRARLIFPIYDHSGRVAGFGGRVLDQGEPKYLNSPETPVYHKGSILYGF
FQARSFIREAKRGFIVEGYFDLISLFEAGVTEVLATLGTALTSHHARQLRSLTSEWYLVF
DADEAGVKAALRAAPIFLNEGLFPKVITLPAGEDPDTFVRKFGAEGFRKLVEEAQDIFDF
MIAVLEPRFSKTPEGRLRLFQEIKPALSAIKDPLLFELELSKLGERLGVSETALRRTFDS
RSSFKVPSPKGKVYSERLVLEFLVHYPEYLSSLLEEGILEHVQNPLYRALIEKLSELENK
SYADLSLEDLELQALLSEILLSPPPFDDVSPEEVYAGIKCWLFRKKSKKKLLEIRQAIKE
AEKAGREEEALRLLKEYQNLCRLNL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
ttgagccttaaagaggcggtaagacgcataaaagaagtagccaacatcgttgatgttatc
ggcgaacacgtagccttaaagaaagtagggcgcaattatttggggctttgtccgtttcat
gctgatcgcaagccttcatttacggtaaacgaagagaggcaaatctttcattgttttggt
tgtggggcaggcggtgatgttatcgccttttacatgaagtttcacaaccttgattttgta
gccgcggtaaaagagctggcctcacgtttcaatatttcgatttcctgggataccaaagaa
gactctttaagagaaaagctttttgaaattaatcaaaaggccaagcgtttttttgagcat
cttttatggtcttcaaaagaaggggaaaaggccagaggctacctaaaagaacgaggtata
tcctctaaggtagccaaggcatttgggctggggtttgctccagcctcttatgatagcctg
gcttcacacttgaagctggtaggggcctcgctagagctagctgagcaggctgggctttta
gtaaggcgtactgacggaagtttttacgatcgttttcgtgcccgtctcatctttcccatt
tatgaccactctgggcgagtggcgggttttgggggtagggtgcttgatcagggagagcca
aaatacctcaactctccagaaactcctgtgtatcacaaagggtctatcctttacggcttt
tttcaagccaggtcttttattagggaagctaaacggggttttattgtagaaggttatttt
gatttgatttccctttttgaggcaggagttaccgaggtgttggccacacttggtacggcc
cttacctcccaccacgcaaggcagctccgttcccttacctctgagtggtatctggtcttt
gatgccgatgaagcgggtgttaaagcggccttacgcgcggcccctatctttctgaatgaa
ggccttttccctaaggtgatcactcttccggctggcgaagaccctgataccttcgtgagg
aagttcggtgccgagggttttcgtaaactagttgaagaagctcaggacatctttgacttt
atgattgcggtgcttgaacctcgtttttctaaaacacctgaagggcgcttaaggctcttt
caggagataaagccagcgctttccgccataaaagatcctcttctctttgagcttgagctt
tctaaactgggagagaggcttggtgtttcagagacagccctgcgacgcacatttgattcc
cgttcttcttttaaggtgccttcgccgaagggaaaagtctattcagaaaggctagtgctt
gaattcctagttcattacccggaatatttatccagtttacttgaagaggggatacttgaa
catgttcaaaatcctctttatcgtgctcttatagaaaagctttctgaacttgaaaacaag
tcttatgcggatctttcccttgaggatttggaacttcaagctttacttagcgaaatactt
ctttctccgcctccttttgatgacgtttctccagaagaagtatatgccggtataaaatgt
tggctgttcagaaagaaaagcaagaaaaaactcttggaaatacgtcaggccattaaagag
gcggaaaaagccggccgggaagaggaagccttgcgtttgttaaaagagtatcaaaatctt
tgccgtttaaatctttaa

DBGET integrated database retrieval system