KEGG   Thermodesulfatator indicus: Thein_0039Help
Entry
Thein_0039        CDS       T01546                                 

Definition
(GenBank) thioesterase superfamily protein
  KO
K07107  acyl-CoA thioester hydrolase [EC:3.1.2.-]
Organism
tid  Thermodesulfatator indicus
Brite
Enzymes [BR:tid01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Thein_0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AEH43924
UniProt: F8A8C0
Position
complement(43895..44305)
Genome map
AA seq 136 aa AA seqDB search
MTQVARVSYRIIYGDTDCGGVVYYANYFRLFEIGRTELLRQAGLTYRDIEEKEGLILPVV
EAQARYRHPARYDDLVTIETRFAELYPHKVRFEYKIFLEEKLLVEGFTVHVPVNKDGRLI
KFPENLYNVLKKISES
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtggcaagggttagttatcgtattatttatggagacaccgattgtggtggc
gtggtttattacgccaattattttaggctctttgaaatagggcgcacggaactgttgcgc
caggctggacttacctaccgcgatattgaagaaaaagaagggcttatcttgccggtagtg
gaggcccaggcgagataccgccatccggcccgttatgatgatttagttaccattgaaacc
aggtttgccgagctttacccccataaggtgcgttttgaatacaaaatctttcttgaagaa
aagctcttggtagaaggcttcaccgttcacgtgccagttaataaagacgggcgtcttata
aaatttcctgaaaacctttataacgttcttaaaaagatatctgaaagctaa

DBGET integrated database retrieval system