KEGG   Thermodesulfatator indicus: Thein_0041Help
Entry
Thein_0041        CDS       T01546                                 

Definition
(GenBank) hypothetical protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
45889..46746
Genome map
AA seq 285 aa AA seqDB search
MPRIPRFFMNDPRAAYHVISRTALPGHDVLGDDEKEHLLHLISWLSQVYFVEVYGFAIMG
NHFHLLCRMLPEDQFSDEEVKRRIRLYYGEKRKIFFYEEVLKKWRKRLGNLSRYVQDIKQ
RFSRWYNKRVDRKGYFWADRFKSVIIETGEALLNCLAYIELNPVRAGIVEKPEDYRWCSL
GYRARKGTGKTFLTLDIGLPSYANKSEKERFRLYRKFVYGKGGLDEPERGTGKIFRQRIN
FFTKGLAIGSKGFVESAALKLKRFLGLKRGRKSKTIKDWTDMAFI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcatcccacgttttttcatgaatgatccacgagccgcttatcatgtaatctcc
cgcacagccttgcccggccatgatgtcctcggcgatgatgaaaaagaacacttactccat
cttattagttggctctcgcaggtctatttcgtcgaagtttatggcttcgccattatgggt
aaccatttccatctcctctgccgcatgctccctgaagaccagttctctgacgaagaagta
aaacgccgcattcgcctctactacggcgagaaacgcaaaattttcttctacgaagaggtg
ctcaaaaaatggcggaaaaggcttggaaatctttctcgatacgtccaggacatcaagcag
cgcttttcacgctggtataacaagcgcgttgaccgcaagggctatttctgggctgacagg
ttcaagtccgtcatcattgagacaggcgaggctctgcttaattgtctggcttacatagag
ttaaacccggtgcgggcaggaattgtagaaaagccagaagactatcgctggtgctcgcta
ggatacagagcaagaaaagggacaggcaaaacttttttgacgcttgatatcggccttccg
tcctatgctaacaaatcagaaaaagagcgcttcaggctttatcggaaatttgtttacggc
aaaggtgggcttgacgagccagaaagagggacaggcaaaatcttccggcaaagaatcaat
ttttttacaaaaggtctggctattggaagcaaaggttttgtagaaagtgcggccttaaag
ttaaaaagatttctcgggctcaaacgaggaagaaaaagtaaaacgataaaagactggaca
gatatggcttttatctga

DBGET integrated database retrieval system