KEGG   Thermodesulfatator indicus: Thein_0042Help
Entry
Thein_0042        CDS       T01546                                 

Definition
(GenBank) ubiquinone/menaquinone biosynthesis methyltransferase
  KO
K03183  demethylmenaquinone methyltransferase / 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase [EC:2.1.1.163 2.1.1.201]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00130  Ubiquinone and other terpenoid-quinone biosynthesis
tid01100  Metabolic pathways
tid01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Thein_0042
Enzymes [BR:tid01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.163  demethylmenaquinone methyltransferase
     Thein_0042
    2.1.1.201  2-methoxy-6-polyprenyl-1,4-benzoquinol methylase
     Thein_0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ubie_methyltran Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: AEH43927
UniProt: F8A8C3
Position
46857..47576
Genome map
AA seq 239 aa AA seqDB search
MSILRGMVALDKKKYVKTKFSKVTRRYDLVNTLGSLGVDHWWRYLCIRELKAYPGPILDL
CAGTLTLSKEIVRQRPRPVVALDITYEMLSYGKLRLARHPALSFIFPVVGDAEKLPFSAN
QFWGASVAFGIRNLADPEKGLKEVLRTLKPGGKFVILEFSRPTLPGFSHLYRLYLNKFMP
LLGGNLTGDREAYEYLADSIEKFPAPEEFSLLMKNCGFKKVKYFQLSFGIVTIYTGLKP
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
ttgagtattttgcgaggcatggtggctctagacaagaaaaaatacgtaaagaccaagttc
tcaaaggtcactcgtcggtacgatttagtaaacactttagggagtctaggggttgatcac
tggtggcgatatttgtgtatccgcgagctcaaggcgtatcctggccctattcttgacctt
tgtgcaggcactctcacgctatctaaagaaatcgttagacaaaggccaagacccgtagtt
gccctagatatcacctatgaaatgctatcttatggtaaacttcgcctggccagacatccg
gccctgagctttattttccctgtagtcggtgacgctgaaaaacttcccttttcagctaac
caattttggggagcatcggtagcttttggtataagaaatctggccgatcctgaaaagggg
ttaaaagaagtgcttcggacattaaaaccaggtgggaaatttgttattcttgaattctca
aggcctactttacctggcttcagccatctttatcgcctttacctcaataaattcatgccc
cttttaggaggaaaccttaccggagaccgcgaagcttacgaatatttagctgattctatt
gaaaaattccctgctcccgaagaattttctcttttaatgaaaaattgcggttttaaaaaa
gtaaagtactttcagttaagttttggcattgtaacaatttataccggccttaagccctaa

DBGET integrated database retrieval system