KEGG   Thermodesulfatator indicus: Thein_0044Help
Entry
Thein_0044        CDS       T01546                                 

Definition
(GenBank) nucleoside recognition domain protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gate
Motif
Other DBs
NCBI-ProteinID: AEH43929
UniProt: F8A8C5
Position
complement(48966..50243)
Genome map
AA seq 425 aa AA seqDB search
MAIMNRIWFYLILLAVLAAAYNNSMEAVTKVSFDAAKTAVKLAIGLIGAMTLWLGIMKVA
EEAGLLEIISRKVKCILVRLFPNVPPTHPAMSAMVMNISANMLGLGNAATPLGIKAMMEL
QKLNPHPERATNAMCLFLAINTSNVTLLPLGVIAVRAAAGASQPASIIFPTIFATTCSTI
AAIVAAKFLARLSGEEPPPRVDSEEVNNDETKQSNPRDLAVIPKGEKLFLIFTLLLFCGL
LLYRIFESPTADTFREIVSFWIVPLLMLGLLFFGYWRGVPVYEKACEGGKEGFQVAVRII
PFLVMILVAIAMFKSSGAFNYLAQLLKPITDPIGFPAEVLPVAILRPLSGSGAFGLMSEI
VARAPDSFASYLASTIQGSTETTFYVLAVYFGAVGIKDPRYAVWAALFADFVGIAAAFFI
CKVTY
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggccattatgaaccgcatttggttctatcttattttgttggcggtcttggcggccgcc
tacaataactccatggaagctgttactaaagtttcctttgatgccgctaagacggcggtg
aaattggccatcggccttatcggagctatgaccctctggctggggatcatgaaggtggcc
gaagaggccggccttctggaaataatttctcgcaaagtaaaatgtatcttggtacgactt
tttcccaatgtcccccctactcatccggctatgagtgctatggtgatgaatatctctgct
aacatgttgggcctgggaaatgctgctactcctcttggtattaaggccatgatggaactt
caaaaacttaaccctcaccctgaacgagccaccaatgccatgtgtcttttcctggccatt
aatacatcaaatgtcacccttttgccgttaggagtgatagccgtgcgtgctgctgcagga
gcctcacagccagcatctattatttttcctactatttttgctacaacctgttctaccata
gcggcaattgtagccgctaagtttttggctcgtttgagtggggaagagcctccacctaga
gtggactccgaagaagtaaataatgacgaaaccaagcagtcaaaccccagagatttagca
gtcatacctaaaggggaaaagctttttttgatttttactctgttgttattttgtgggctt
ttgctttaccgaatttttgagtctcctacagctgatactttccgtgaaatagtttctttt
tggatagttcctcttttgatgctagggttacttttctttggttactggcgaggggtacct
gtttatgagaaggcctgtgaaggaggcaaagaaggctttcaggtggcagtaaggattatt
ccatttctggtaatgattttggtagccattgctatgttcaagtcttctggagcctttaac
tatctagctcaactgcttaagcccattactgatcctattggtttcccggctgaggttttg
cctgtagctattttgcgtcctctttctggttcgggggcctttggtcttatgagtgaaatt
gtagctcgtgcccctgatagttttgcctcttaccttgcttcgacgatccaaggttcaacc
gaaaccaccttttacgtattggctgtttattttggagcagtaggaataaaagatccgcgt
tacgcggtttgggcagccctttttgccgattttgtgggaatagccgcggctttttttatc
tgcaaggttacttattga

DBGET integrated database retrieval system