KEGG   Thermodesulfatator indicus: Thein_0049Help
Entry
Thein_0049        CDS       T01546                                 

Definition
(GenBank) phosphoglucose isomerase (PGI)
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00010  Glycolysis / Gluconeogenesis
tid00030  Pentose phosphate pathway
tid00500  Starch and sucrose metabolism
tid00520  Amino sugar and nucleotide sugar metabolism
tid01100  Metabolic pathways
tid01110  Biosynthesis of secondary metabolites
tid01120  Microbial metabolism in diverse environments
tid01130  Biosynthesis of antibiotics
tid01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thein_0049
   00030 Pentose phosphate pathway
    Thein_0049
   00500 Starch and sucrose metabolism
    Thein_0049
   00520 Amino sugar and nucleotide sugar metabolism
    Thein_0049
Enzymes [BR:tid01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     Thein_0049
Exosome [BR:tid04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Thein_0049
  Exosomal proteins of other body fluids (saliva and urine)
   Thein_0049
  Exosomal proteins of colorectal cancer cells
   Thein_0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-ProteinID: AEH43934
UniProt: F8A8D0
Position
complement(53277..55067)
Genome map
AA seq 596 aa AA seqDB search
MPRLAKIVLAILLRVSIKLKRQKYQEEEMDSQKRARLLRPTKLSEDEKRKIISAIFAKDP
SVFTDDQDLQKAIKNRLGWVDAPQRMRSKLPEIKEFAAKVKEEFSEIVLCGMGGSSLFPL
ALTKIFGPEEGWPNFNVLDTTDPEEIAKIEEKDLKKTLFIIASKSGTTIETLTQFHYFWE
KVSQITDNPGSHFVAITDEGTPLHKEGEEKAFLKVFLNPKDIGGRYAALTYVGLLPAALM
GLEVERFLDKAQEMQEACSPDIPWELNPAAWLSEYMAEHFFLGHDKLTIMADPLLRPFSL
WIEQLVAESLGKEFTGIIPIVGESPGSPTVYGPDRVFVYLGLRGRQDLYRRLFSDLKEAG
FPLKQYFLDDRYELGAECFRWELAVALCGVWLGLNPFDEPDVIRAKKKTKEVLDTFVKTG
DFPIEFYVDDDLDVGFLYAGGLKVQYPRLRAVMKKLLYETPPWGYFAFLPFLPYDPEIEE
IFTDLRTLLRGRRQCSTIMGFGPRYLHSIGQLFKGGPRSGRFFIFTRKGRREDQIIPEFG
FTFWDLEFAQAYGDFQALSEDNRPVLHIHLTDNYIEDLKKFYQFMEEVTRLTEDDT
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgattagccaaaatagttcttgccatacttttgagggtgagtataaaacttaaa
agacaaaaataccaggaggaagaaatggattctcaaaaaagagcaagacttttgcgtccg
actaagttgagtgaagacgaaaagagaaagatcatttccgctatatttgctaaagatcct
tcagtttttacagatgaccaagaccttcaaaaggccattaaaaatcgcctaggttgggtg
gatgctcctcaacgtatgcgctcaaaactcccagaaataaaagaatttgctgccaaagta
aaagaggagttttctgaaattgttctttgtggtatggggggatcgagccttttccccctg
gctctgaccaagatttttggtccagaagaaggatggcccaattttaacgtgcttgatacc
actgaccctgaagaaatagccaaaatcgaagaaaaagacctgaaaaagacccttttcatt
attgctagcaagtcaggcaccactatagaaaccttaacccagtttcactatttttgggaa
aaggtatcccagataaccgataatcccggaagccatttcgtggctatcaccgacgaaggt
actcctcttcacaaagaaggggaagaaaaggcttttctaaaagtttttttgaacccgaaa
gatataggtgggcgttatgcagcgcttacatacgttggccttttgccggctgcccttatg
gggcttgaggtggaacgatttcttgataaagctcaagaaatgcaagaggcttgctctcct
gatattccctgggagctcaatcccgccgcctggctctcagagtatatggccgaacatttc
ttcttaggtcatgataaacttaccattatggccgatcctctactcaggcctttctccctg
tggatagaacaattagtagccgaaagccttggtaaggagtttactggaattattcccatt
gtgggggaatctccaggttctcctacggtttatggtcctgaccgggtttttgtctatctt
ggtttaaggggtaggcaggatctttatcgtcgcctctttagtgaccttaaagaagcgggt
tttcccttgaagcaatattttcttgatgaccgttacgaattaggagctgagtgttttcgc
tgggagctggctgtagccctctgtggggtatggttagggcttaatccctttgatgagcct
gatgtaattcgggccaagaaaaaaaccaaagaggtattggatacctttgtaaaaaccgga
gactttcccattgaattttatgtggatgatgatttagacgtgggttttttatacgccggg
gggttaaaagtccagtatcctaggctaagggcggtgatgaaaaaactactttacgaaaca
cctccctggggatatttcgcctttctcccctttttaccttacgatcctgagatagaagaa
atttttactgatttaagaacccttttgcgcggaagacgccagtgttccactattatgggt
tttggtcctcgatatcttcattctattggccagctctttaaaggtgggccacgttctggg
cgattttttatttttacccgtaaaggtcggcgggaagatcaaattattccagaattcggt
tttactttttgggatctcgagtttgctcaggcctacggtgactttcaggccttaagtgaa
gataatcgcccggtacttcacattcaccttacggataattacattgaagatttgaaaaaa
ttttatcaatttatggaggaggtcactcgtttaaccgaagatgatacttaa

DBGET integrated database retrieval system