KEGG   Thermodesulfatator indicus: Thein_0050Help
Entry
Thein_0050        CDS       T01546                                 

Definition
(GenBank) hypothetical protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_Tnp_IS1595 PemK_toxin Lar_restr_allev TF_Zn_Ribbon BIR DUF2318 zf-Sec23_Sec24
Motif
Other DBs
NCBI-ProteinID: AEH43935
UniProt: F8A8D1
Position
55137..55439
Genome map
AA seq 100 aa AA seqDB search
MREKVSSTKEEGKKRRFVIIKKQPFFTNTTRIVCPFCGNDEDFWEHAEGVTIKTHYVQNE
DGSFSPVSDDTQIFGEIRFICGKCNSDLTKYHKQFLEMLF
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaaaaagttagttctaccaaggaagaaggcaaaaaaaggcgctttgtcatcatt
aaaaaacagcccttttttaccaatactaccaggatagtctgtcctttttgcggcaatgac
gaagacttctgggagcatgctgaaggagtcactataaaaacccattacgttcagaacgaa
gacggaagcttctcccccgtaagcgacgatacccaaatttttggagaaattcgttttata
tgcggcaaatgtaattccgatttaacaaagtatcacaaacaattccttgagatgctcttt
taa

DBGET integrated database retrieval system