KEGG   Thermodesulfatator indicus: Thein_0054Help
Entry
Thein_0054        CDS       T01546                                 

Definition
(GenBank) hypothetical protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(57262..57816)
Genome map
AA seq 184 aa AA seqDB search
MLKFFKKFRLSSDKKKDADVEKGFLLFENTSEVIRAEELLKKAGFPVKVKAPPPEVRQGC
DMVIEFPLMLKLEISRFLEENNLRPLSLVPVEDPLLEPVDMCRVKDFGDYIMIHVANMKI
TVDKRNKAIVNISGGGCPDVPFLASIMVGKPLDQTPEPRAFGHTLCGYTLQLALEEAKKR
CLPS
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaattttttaaaaaatttcgattatcttcagataagaaaaaagacgcagacgtt
gaaaaaggttttttgctttttgaaaacaccagtgaagtgataagagccgaggagttgctt
aaaaaagcaggttttccggtaaaagttaaagctcccccgccagaagtgcgccaagggtgc
gacatggttattgagtttcccttgatgctcaaactggaaatctctcgctttcttgaagag
aacaatttaaggccactttctctggtacctgtagaggaccctttgcttgaaccggttgat
atgtgtcgcgtaaaagacttcggagattacattatgattcacgtagctaacatgaaaata
actgttgataaaagaaataaagccatagtgaatatttcaggaggtgggtgcccggatgtg
ccgtttctggcctctattatggtgggaaaacctttagaccagactccagagccaagggcg
ttcgggcatactctttgtggttatacccttcagctggcccttgaggaggccaagaaaaga
tgcttgccatcgtag

DBGET integrated database retrieval system