KEGG   Thermodesulfatator indicus: Thein_0055Help
Entry
Thein_0055        CDS       T01546                                 

Definition
(GenBank) SirA-like domain-containing protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(57825..58037)
Genome map
AA seq 70 aa AA seqDB search
MNTVDARGLSCPQPVLLTLEAIEKMKEGELVVLVDTEAARENVSRAVASKGWKVKEIVEE
NGEYKLIIAK
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagtagatgccagagggctttcctgtcctcagcctgttttactaacccttgaa
gctattgaaaaaatgaaggaaggtgagctggtggtcctggtagataccgaagcggctaga
gaaaacgtaagtcgggctgtagcttctaaaggctggaaggttaaagaaatagttgaagaa
aatggcgaatacaaacttataatcgctaaatag

DBGET integrated database retrieval system