KEGG   Thermodesulfatator indicus: Thein_0056Help
Entry
Thein_0056        CDS       T01546                                 

Definition
(GenBank) hypothetical protein
  KO
K07112  
uncharacterized protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(58050..59132)
Genome map
AA seq 360 aa AA seqDB search
MKRNFFATTLGIISVGVVIGVLAPLLQKFGNPGNMGVCVACFLRDIAGSLGLHRAAVVQY
LRPEIPSFVLGSFLAAMLFKEFRPRGGSAPIIRFFLGFFAMIGALVFLGCPWRTILRLAG
GDLNAIFGLIGLVTGISIGIFFFKQGFDLGRTQRLGWGAGLVFPVVMAGLLLLRLVFPPI
PGEPKSGVLFYSIKGPGTMFAPVFISIGAGLLIGILAQRSRFCTMGAFRDLILFRQGHLF
FGVLAFFSTALLVNLILGQFHPGFTGQPAAHTQAFWNFAGMVLAGLAFALAGGCPGRQLF
LSGEGDTDAAIFALGMLIGAAFAHNFAMAATPKGISPHSMAGVIIGLIFCVAVGLIMRRK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaacttttttgctaccactttgggcataatttccgtaggagtggttataggg
gttcttgcacctctgcttcagaagtttggtaatcctggcaacatgggtgtctgtgtggcc
tgttttttaagggatattgccggttctttaggtcttcatagggcagcagtggttcaatac
cttcgtccagaaatcccttcttttgtcttgggttctttcttagcggccatgctatttaaa
gagttcaggcctagaggtggttcggcccctattatcaggtttttcctcggttttttcgct
atgataggcgctcttgtgtttctgggctgcccctggagaactattttgagactcgccggt
ggagacctgaacgccatctttggtcttattggcctggtaaccggtatttctatagggata
ttcttttttaagcaaggttttgatttaggacgcactcagcgtttaggctggggagccggc
ttagtctttcccgtcgtcatggccggtcttttgcttttaaggcttgtttttccgcctatt
cctggtgaacccaaaagtggtgttcttttttacagtattaaaggcccaggtaccatgttt
gcccctgtctttatttccataggagcaggcctcttaatagggattcttgcccagagaagc
cgtttttgcaccatgggtgcctttagggacctcattcttttccgccagggtcatctcttt
ttcggagttcttgcctttttcagtaccgcccttttggtaaacttaatcttaggccaattt
catccggggtttaccgggcagccagctgctcatacccaggccttctggaattttgccggt
atggtactggcgggtttagcctttgccctggcaggaggatgtcccgggcggcaattattc
ctttcaggtgaaggtgataccgatgcggccatttttgccctgggtatgcttattggagcg
gcttttgctcataactttgccatggccgctactcctaaaggaattagccctcatagtatg
gctggggtaatcattggtttaatcttttgcgtggccgtaggccttattatgagaagaaaa
tag

DBGET integrated database retrieval system