KEGG   Thermodesulfatator indicus: Thein_0059Help
Entry
Thein_0059        CDS       T01546                                 

Definition
(GenBank) putative transcriptional regulator, AsnC family
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_AsnC-type HTH_24 B-block_TFIIIC HTH_36 HTH_Crp_2 MarR
Motif
Other DBs
NCBI-ProteinID: AEH43944
UniProt: F8A8E0
Position
60825..61364
Genome map
AA seq 179 aa AA seqDB search
MAFVQCIYWFACPQNSAINFFMLDSLDKKIIAALSEGLPLTLRPYEDLAKNLDISEEELF
SRIKKLKEKGVIRRLGGTIRHDQAGIKGNVMVAWIVPSNRLDEVGQKCARYPFITHCYVR
ETAPDWPYNFYTMVHAENETECLKLVENLAEELNLKDYELLFTKKEIVRRMRRYFSEEI
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgtccagtgcatttattggtttgcctgtccccaaaactctgctataaatttt
ttcatgcttgatagtcttgataaaaaaataatagccgccttaagtgaaggattacctctt
actcttaggccttacgaggatcttgccaaaaatttggacatttcagaagaagaacttttt
tcgcgaattaaaaaactcaaagaaaaaggagttataaggcgccttggaggcaccattagg
cacgaccaggctggcattaaaggaaacgttatggtggcctggattgtccccagcaaccgc
ctcgatgaagtggggcaaaaatgtgcccgctatccttttattacccactgctacgtaaga
gaaacagcgcctgattggccttacaacttctataccatggtccacgctgaaaacgaaaca
gaatgcctaaaactcgttgaaaaccttgccgaagaactaaaccttaaagattatgaactt
ctttttaccaaaaaagaaatcgtgcgccgtatgcgccgctatttttctgaagaaatctaa

DBGET integrated database retrieval system