KEGG   Thermodesulfatator indicus: Thein_0062Help
Entry
Thein_0062        CDS       T01546                                 

Definition
(GenBank) Radical SAM domain protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM DUF1848 Fer4_12
Motif
Other DBs
NCBI-ProteinID: AEH43947
UniProt: F8A8E3
Position
complement(63657..64598)
Genome map
AA seq 313 aa AA seqDB search
MKVVKVKRRSQVLKNPAFGCLKDIPSVNVTRGCLHRCAYCYARVFPETPKNEVQLYENLP
EKLEKEIVSRLKRGRKPKAVAFSTASDAFQPNEAILQISFECMKILLKSGVAVSFLTKGR
IPEKFFSLFNEHKGLVKPRFGLVSLSSDYRLIFEPRTAPLYLRLRLIEKAAKLGLEPAVR
IDPVIPGLTDREEMVESLMRRLAMAGVKEVSVSYLVLRPKVMEQMEKELPYAFWQKIFSV
YQGEPWCQVITSATTKLVRKEIREKGYALFKEIGRAFGLTVKICGCKNPDLPFEFCAPWE
IKEKMPKQKELFK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgtaaaagtaaagcgtaggtctcaggtgcttaaaaatccagcctttgggtgt
ttgaaagatataccatcagtgaatgttactagaggctgtcttcatcgctgtgcttattgc
tacgccagggtttttccggagactcccaaaaatgaggttcagctttatgaaaatcttccg
gaaaagcttgaaaaagagatagtctcacgacttaagcgtggccgaaagccaaaggctgta
gccttttctaccgcaagtgacgcctttcagcctaacgaagcaattttacaaatatctttt
gaatgcatgaaaatacttcttaaatcaggcgttgcggtgtcgtttcttaccaaagggcgc
atacctgaaaaattttttagtcttttcaatgagcataagggcctagttaagccgagattt
ggcctggtaagcttgagttcggattatcgcctgatttttgaaccgcggacggctccgctt
tatctgcgtctcaggttgattgaaaaagcggcaaagcttggtcttgaacctgcagtgcgc
atagaccccgtaattcctggcctaactgaccgggaagaaatggttgagtctcttatgagg
cgccttgctatggctggtgtaaaagaagtttctgttagttatctcgtgcttcggccaaag
gtgatggagcagatggaaaaagaattaccttacgctttctggcaaaaaatattttcggtc
tatcagggtgagccttggtgccaggtaattacttcagctaccaccaaacttgtccgaaaa
gaaatcagagaaaagggttacgcgctttttaaggaaataggtcgggcttttggccttacc
gtaaaaatttgcggttgcaaaaaccctgaccttccctttgaattctgcgcgccgtgggag
ataaaagagaaaatgccgaaacaaaaggaactttttaaataa

DBGET integrated database retrieval system