KEGG   Thermodesulfatator indicus: Thein_0065Help
Entry
Thein_0065        CDS       T01546                                 

Definition
Alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tid  Thermodesulfatator indicus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tid00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:tid00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:tid02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(67685..69199)
Genome map
AA seq 504 aa AA seqDB search
MFKKLRFIISLCFCLLFIQVLSAHAFTYPDRVFFHKPQVKVKKAKYVILLIGDGMGYWHV
DALRRYLNVSKTNMESLRYFGYMTTFMRNSTGEGGLSGEYWDDPNELGSYDPALGGRTPW
EIQPVPAYVDEGATDSAAAGSALASGHKTVKYALNVVPKPEGYPADEPFTVKYYPTIVDF
AEAKGMATGVVTSVPFSHATPAAFIAKTQYRKNYGEIARQMIFSNLDVIMGAGHPYYDDN
GNLREEPNFYYWSRNKGPYIDDEDGEALYEKVVNGVRGRVFVDKKEDFEDLADGDGLFHG
GPMPRRVFGLAQVANTLQASRNIDDGDPSDDWKVGGQAFITNVPSLETMTRAALEVLEQD
EDGFFVMIEGGAIDWASHANNMTRMLEEIIDFDNAVKAVIDWVNDPNNGSNWDNTLVVVV
ADHETGHLQPLNVTGDEVIKEQCWGLNCEGWHHHTNSLVPIYAQGVCARALKAKYDGDIK
DNTQIFKVMYQAIERGCYELRIPE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaattacgtttcattatttcgttatgtttttgtctgttatttattcaggtt
ttgtcagcccatgcctttacttatcctgaccgagtcttttttcacaaaccgcaggttaag
gtcaaaaaagctaagtacgtcatacttttgataggagacgggatgggctattggcacgtt
gatgccttacgtagatacttgaatgtaagcaaaaccaatatggaaagccttaggtacttt
ggttatatgactacttttatgagaaattctacaggagaaggtggacttagtggagaatac
tgggatgatcctaacgaacttggtagttatgatcccgcgctaggaggtcgtactccgtgg
gaaatacaaccagttcctgcttatgtagatgagggggctacagattcggcagctgctggt
agcgcactagccagtggccacaaaacagtaaaatatgcattgaatgtagttcctaagcct
gaaggatatcctgctgatgaaccttttacggtcaaatattatcccaccattgttgatttt
gccgaggccaaaggtatggccaccggcgtagtaaccagtgttcctttctcccatgccact
cccgctgcttttattgccaaaacccagtaccgtaaaaattatggggaaatagctcgtcaa
atgattttttctaacttggatgtaattatgggagccggacatccttattacgatgacaac
ggcaatctacgcgaagagcctaacttttattactggtctcgcaataaaggaccctatatc
gatgatgaagacggtgaagctttatatgaaaaagtagtaaacggagtaagaggtagagtt
tttgtcgataaaaaagaagattttgaggatttagccgatggtgacggactctttcacgga
ggccctatgcctagacgggtattcggattggctcaggtagctaatactttacaggcttct
cgcaacatagatgatggagatccttctgatgactggaaagtcggtggccaggcctttata
accaatgttccctctcttgaaaccatgaccagagctgctcttgaagtgcttgaacaggac
gaagacggcttttttgtaatgattgaaggcggagccattgattgggctagccacgctaac
aacatgaccagaatgcttgaagaaataattgattttgataatgctgtcaaagcagttatt
gattgggttaatgaccccaataatggaagcaattgggacaatactttggtggttgtagtg
gctgatcacgaaaccggacatctccagcctttaaatgtaaccggcgacgaagttataaaa
gaacaatgctgggggctaaattgtgaaggctggcatcatcataccaatagtctggtaccg
atctatgcccagggagtgtgcgccagagccttaaaggccaaatatgatggagacataaaa
gacaatactcaaatctttaaggtaatgtatcaggctattgaaaggggctgctacgaacta
agaatacctgaataa

DBGET integrated database retrieval system